You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
MYCN
N-myc proto-oncogene protein

Protein Summary
Description
Positively regulates the transcription of MYCNOS in neuroblastoma cells. This gene is a member of the MYC family and encodes a protein with a basic helix-loop-helix (bHLH) domain. This protein is located in the nucleus and must dimerize with another bHLH protein in order to bind DNA. Amplification of this gene is associated with a variety of tumors, most notably neuroblastomas. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000281043
  • ENSP00000281043
  • ENSG00000134323

Symbol
  • BHLHE37
  • NMYC
  • NMYC
  • ODED
  • MODED
  • N-myc
  • bHLHe37
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
1
cell type or tissue
0.81
transcription factor perturbation
0.8
transcription factor binding site profile
0.77
microRNA
0.72


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2226.83   (req: < 5)
Gene RIFs: 315   (req: <= 3)
Antibodies: 321   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2226.83   (req: >= 5)
Gene RIFs: 315   (req: > 3)
Antibodies: 321   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (16)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (219)
1 – 10 of 219
AURKA
Tchem
Family: Kinase
Novelty: 0.00069833
Score: 0.976
Data Source: STRINGDB
NDRG1
Tbio
Novelty: 0.00461958
Score: 0.919
Data Source: STRINGDB
ALK
Tclin
Family: Kinase
Novelty: 0.00032051
Score: 0.849
Data Source: STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.846
Data Source: STRINGDB
SIRT1
Tchem
Family: Epigenetic
Novelty: 0.00025951
Score: 0.808
Data Source: STRINGDB
SHH
Tchem
Novelty: 0.00033539
Score: 0.802
Data Source: STRINGDB
CDKN2A
Tbio
Novelty: 0.0001824
Score: 0.799
Data Source: STRINGDB
CDKN2A
Tbio
Family: Enzyme
Novelty: 0.0001824
Score: 0.799
Data Source: STRINGDB
EZH2
Tclin
Family: Epigenetic
Novelty: 0.00057242
Score: 0.788
Data Source: STRINGDB
LIN28B
Tbio
Family: TF
Novelty: 0.00685329
Score: 0.772
Data Source: STRINGDB
Publication Statistics
PubMed Score  2226.83

PubMed score by year
PubTator Score  1950.29

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEH
1-70
SSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGP
70-140
PTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPA
140-210
SAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVV
210-280
TVEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKI
280-350
KSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKV
350-420
VILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC
420-464
MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLGGLGGLTPNPVILQDCMWSGFSAREKLERAVSEKLQHGRGPPTAGSTAQSPGAGAASPAGRGHGGAAGAGRAGAALPAELAHPAAECVDPAVVFPFPVNKREPAPVPAAPASAPAAGPAVASGAGIAAPAGAPGVAPPRPGGRQTSGGDHKALSTSGEDTLSDSDDEDDEEEDEEEEIDVVTVEKRRSSSNTKAVTTFTITVRPKNAALGPGRAQSSELILKRCLPIHQQHNYAAPSPYVESEDAPPQKKIKSEASPRPLKSVIPPKAKSLSPRNSDSEDSERRRNHNILERQRRNDLRSSFLTLRDHVPELVKNEKAAKVVILKKATEYVHSLQAEEHQLLLEKEKLQARQQQLLKKIEHARTC