You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
STATH
Statherin

Protein Summary
Description
Salivary protein that stabilizes saliva supersaturated with calcium salts by inhibiting the precipitation of calcium phosphate salts. It also modulates hydroxyapatite crystal formation on the tooth surface.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000246895
  • ENSP00000246895
  • ENSG00000126549
  • ENST00000381060
  • ENSP00000370448
  • ENST00000615994
  • ENSP00000484341
  • ENST00000634727
  • ENSP00000489107
  • ENSG00000282891
  • ENST00000635437
  • ENSP00000489569
  • ENST00000635686
  • ENSP00000489243

Symbol
  • STR
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.58
cell line
0.5
metabolite
0.45
chemical
0.41
protein complex
0.4


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 164.68   (req: < 5)
Gene RIFs: 10   (req: <= 3)
Antibodies: 57   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 164.68   (req: >= 5)
Gene RIFs: 10   (req: > 3)
Antibodies: 57   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (40)
1 – 10 of 40
HTN1
Tbio
Novelty: 0.01397175
Score: 0.905
Data Source: STRINGDB
HTN3
Tbio
Novelty: 0.00204073
Score: 0.825
Data Source: STRINGDB
OPRPN
Tdark
Novelty: 0.01777013
Score: 0.808
Data Source: STRINGDB
CST4
Tbio
Novelty: 0.010423
Score: 0.788
Data Source: STRINGDB
MUC7
Tbio
Novelty: 0.00971879
Score: 0.778
Data Source: STRINGDB
MUC5B
Tbio
Novelty: 0.00088548
Score: 0.705
Data Source: STRINGDB
C4BPA
Tbio
Novelty: 0.00381157
Score: 0.67
Data Source: STRINGDB
CTRC
Tchem
Family: Enzyme
Novelty: 0.00326846
Score: 0.649
Data Source: STRINGDB
PRPF3
Tbio
Novelty: 0.01841457
Score: 0.573
Data Source: STRINGDB
PRR27
Tdark
Novelty: 3.23076923
Score: 0.556
Data Source: STRINGDB
Publication Statistics
PubMed Score  164.68

PubMed score by year
PubTator Score  260.28

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF
1-70
MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYPQPYQPQYQQYTF