You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LTF
Lactotransferrin

Protein Summary
Description
Transferrins are iron binding transport proteins which can bind two Fe(3+) ions in association with the binding of an anion, usually bicarbonate. Lactotransferrin is a major iron-binding and multifunctional protein found in exocrine fluids such as breast milk and mucosal secretions. Has antimicrobial activity, which depends on the extracellular cation concentration. Antimicrobial properties include bacteriostasis, which is related to its ability to sequester free iron and thus inhibit microbial growth, as well as direct bactericidal properties leading to the release of lipopolysaccharides from the bacterial outer membrane. Can also prevent bacterial biofilm development in P.aeruginosa infection. Has weak antifungal activity against C.albicans. Has anabolic, differentiating and anti-apoptotic effects on osteoblasts and can also inhibit osteoclastogenesis, possibly playing a role in the regulation of bone growth. Promotes binding of species C adenoviruses to epithelial cells, promoting a ...more
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
PubMedID
1
biological term
0.97
molecular function
0.96
small molecule perturbation
0.86


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 687.53   (req: < 5)
Gene RIFs: 185   (req: <= 3)
Antibodies: 1219   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 687.53   (req: >= 5)
Gene RIFs: 185   (req: > 3)
Antibodies: 1219   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 45
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (32)
1 – 5 of 32
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (84)
Amyloid fiber formation (R-HSA-977225)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amyloid fiber formation
Reactome
Antimicrobial peptides
Reactome
Disease
Reactome
Immune System
Reactome
Infectious disease
Name
Explore in Pharos
Explore in Source
Amyloid fiber formation
Antimicrobial peptides
Disease
Immune System
Infectious disease
Gene Ontology Terms (58)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
CAFA
Inferred from Direct Assay (IDA)
MGI
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (165)
1 – 10 of 165
DDX31
Tbio
Family: Enzyme
Novelty: 4
p_int: 0.999997774
p_ni: 0.000002226
Data Source: BioPlex
SNX27
Tbio
Novelty: 0.02796021
p_int: 0.999965689
p_ni: 0.000034311
Data Source: BioPlex
HBM
Tdark
Novelty: 0.00771597
p_int: 0.999801173
p_ni: 0.000198827
Score: 0.2
Data Source: BioPlex,STRINGDB
ICE2
Tbio
Novelty: 0.05712472
p_int: 0.999658439
p_ni: 0.000341561
Data Source: BioPlex
CCDC148
Tdark
Novelty: 8.8
p_int: 0.999161952
p_ni: 0.000838047
Score: 0.196
Data Source: BioPlex,STRINGDB
FRMD1
Tdark
Novelty: 2.81564246
p_int: 0.998384769
p_ni: 0.001615231
Data Source: BioPlex
POLL
Tbio
Family: Enzyme
Novelty: 0.00129691
p_int: 0.994555369
p_ni: 0.005444631
Score: 0.17
Data Source: BioPlex,STRINGDB
FN3KRP
Tbio
Family: Kinase
Novelty: 0.13370228
p_int: 0.97039602
p_ni: 0.02960398
Score: 0.235
Data Source: BioPlex,STRINGDB
CDK15
Tchem
Family: Kinase
Novelty: 3.88235294
p_int: 0.968423716
p_ni: 0.031576279
p_wrong: 5e-9
Data Source: BioPlex
TMEM237
Tdark
Novelty: 0.52565707
p_int: 0.960652736
p_ni: 0.039347264
Score: 0.175
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  687.53

PubMed score by year
PubTator Score  214.74

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAE
1-70
NRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRR
70-140
TAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFS
140-210
YSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVN
210-280
GKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNL
280-350
RKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYT
350-420
AGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNI
420-490
PMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGD
490-560
VAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQ
560-630
VLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSP
630-700
LLEACEFLRK
700-710
MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAARRARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYTAGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHTAVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNSNERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRKPVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNLLFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK