You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
C9
Complement component C9

Protein Summary
Description
Constituent of the membrane attack complex (MAC) that plays a key role in the innate and adaptive immune response by forming pores in the plasma membrane of target cells (PubMed:9634479, PubMed:9212048, PubMed:26841934). C9 is the pore-forming subunit of the MAC (PubMed:4055801, PubMed:26841934). This gene encodes the final component of the complement system. It participates in the formation of the Membrane Attack Complex (MAC). The MAC assembles on bacterial membranes to form a pore, permitting disruption of bacterial membrane organization. Mutations in this gene cause component C9 deficiency. [provided by RefSeq, Feb 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000263408
  • ENSP00000263408
  • ENSG00000113600

Symbol
  • C9D
  • ARMD15
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.92
gene perturbation
0.89
cell line
0.71
cell type or tissue
0.62
disease
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 111.12   (req: < 5)
Gene RIFs: 29   (req: <= 3)
Antibodies: 478   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 111.12   (req: >= 5)
Gene RIFs: 29   (req: > 3)
Antibodies: 478   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (25)
Complement cascade (R-HSA-166658)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Complement cascade
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Regulation of Complement cascade
Reactome
Terminal pathway of complement
Name
Explore in Pharos
Explore in Source
Complement cascade
Immune System
Innate Immune System
Regulation of Complement cascade
Terminal pathway of complement
Gene Ontology Terms (15)
Items per page:
10
1 – 9 of 9
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
HPA
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
UniProtKB-SubCell
Protein-Protein Interactions (84)
1 – 10 of 84
APOE
Tbio
Novelty: 0.0000621
p_int: 0.999854944
p_ni: 0.000144993
p_wrong: 6.3e-8
Score: 0.401
Data Source: BioPlex,STRINGDB
CST6
Tbio
Novelty: 0.02446068
p_int: 0.875974003
p_ni: 0.122121429
p_wrong: 0.001904568
Score: 0.187
Data Source: BioPlex,STRINGDB
CLU
Tbio
Novelty: 0.00056402
Score: 0.963
Data Source: Reactome,STRINGDB
CD59
Tbio
Novelty: 0.00056697
Score: 0.961
Data Source: Reactome,STRINGDB
C8A
Tbio
Novelty: 0.01887053
Score: 0.96
Data Source: Reactome,STRINGDB
VTN
Tbio
Family: TF
Novelty: 0.00057817
Score: 0.957
Data Source: Reactome,STRINGDB
C8B
Tbio
Novelty: 0.02916959
Score: 0.956
Data Source: Reactome,STRINGDB
C5
Tclin
Novelty: 0.0030075
Score: 0.954
Data Source: Reactome,STRINGDB
C8G
Tbio
Novelty: 0.02481402
Score: 0.939
Data Source: Reactome,STRINGDB
FGB
Tbio
Novelty: 0.00757235
Score: 0.939
Data Source: STRINGDB
Publication Statistics
PubMed Score  111.12

PubMed score by year
PubTator Score  417.21

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVF
1-70
GQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRP
70-140
PCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEK
140-210
NFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETY
210-280
QLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSG
280-350
SLGGLYELIYVLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSEN
350-420
LIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLK
420-490
KQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK
490-559
MSACRSFAVAICILEISILTAQYTTSYDPELTESSGSASHIDCRMSPWSEWSQCDPCLRQMFRSRSIEVFGQFNGKRCTDAVGDRRQCVPTEPCEDAEDDCGNDFQCSTGRCIKMRLRCNGDNDCGDFSDEDDCESEPRPPCRDRVVEESELARTAGYGINILGMDPLSTPFDNEFYNGLCNRDRDGNTLTYYRRPWNVASLIYETKGEKNFRTEHYEEQIEAFKSIIQEKTSNFNAAISLKFTPTETNKAEQCCEETASSISLHGKGSFRFSYSKNETYQLFLSYSSKKEKMFLHVKGEIHLGRFVMRNRDVVLTTTFVDDIKALPTTYEKGEYFAFLETYGTHYSSSGSLGGLYELIYVLDKASMKRKGVELKDIKRCLGYHLDVSLAFSEISVGAEFNKDDCVKRGEGRAVNITSENLIDDVVSLIRGGTRKYAFELKEKLLRGTVIDVTDFVNWASSINDAPVLISQKLSPIYNLVPVKMKNAHLKKQNLERAIEDYINEFSVRKCHTCQNGGTVILMDGKCLCACPFKFEGIACEISKQKISEGLPALEFPNEK