You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
CHRNA1
Acetylcholine receptor subunit alpha

Protein Classes
Protein Summary
Description
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane. The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha subunits and 1 each of the beta, gamma, and delta subunits. This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Nov 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000261007
  • ENSP00000261007
  • ENSG00000138435
  • ENST00000348749
  • ENSP00000261008

Symbol
  • ACHRA
  • CHNRA
  • ACHRA
  • ACHRD
  • CHRNA
  • CMS1A
  • CMS1B
  • CMS2A
  • FCCMS
  • SCCMS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.96
protein domain
0.85
phenotype
0.65
tissue
0.61
disease
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 47.88   (req: < 5)
Gene RIFs: 29   (req: <= 3)
Antibodies: 396   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 47.88   (req: >= 5)
Gene RIFs: 29   (req: > 3)
Antibodies: 396   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 7
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 15
Approved Drugs (15)
1 – 10 of 15
tubocurarine
chemical structure image
mecamylamine
chemical structure image
decamethonium
chemical structure image
suxamethonium
chemical structure image
rapacuronium
chemical structure image
atracurium
chemical structure image
pipecuronium
chemical structure image
vecuronium
chemical structure image
cisatracurium
chemical structure image
pancuronium
chemical structure image
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (12)
Acetylcholine binding and downstream events (R-HSA-181431)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Acetylcholine binding and downstream events
Reactome
Highly calcium permeable nicotinic acetylcholine receptors
Reactome
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Reactome
Neuronal System
Reactome
Neurotransmitter receptors and postsynaptic signal transmission
Name
Explore in Pharos
Explore in Source
Acetylcholine binding and downstream events
Highly calcium permeable nicotinic acetylcholine receptors
Highly calcium permeable postsynaptic nicotinic acetylcholine receptors
Neuronal System
Neurotransmitter receptors and postsynaptic signal transmission
Gene Ontology Terms (31)
Items per page:
10
1 – 5 of 5
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
SynGO
Inferred from Mutant Phenotype (IMP)
MGI
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (97)
1 – 10 of 97
RAPSN
Tbio
Novelty: 0.00693723
Score: 0.974
Data Source: STRINGDB
AGRN
Tbio
Novelty: 0.0018427
Score: 0.942
Data Source: STRINGDB
CHRND
Tclin
Family: IC
Novelty: 0.04863852
Score: 0.927
Data Source: STRINGDB
DAG1
Tbio
Family: Enzyme
Novelty: 0.00185637
Score: 0.923
Data Source: STRINGDB
CHRNA7
Tchem
Family: IC
Novelty: 0.00717396
Score: 0.922
Data Source: STRINGDB
ITGB1
Tclin
Novelty: 0.00074903
Score: 0.921
Data Source: STRINGDB
UTRN
Tbio
Novelty: 0.00225431
Score: 0.921
Data Source: STRINGDB
DMD
Tclin
Novelty: 0.00029078
Score: 0.921
Data Source: STRINGDB
CHRM1
Tclin
Family: GPCR
Novelty: 0.00648721
Score: 0.919
Data Source: STRINGDB
CHRNA9
Tchem
Family: IC
Novelty: 0.07858477
Score: 0.909
Data Source: STRINGDB
Publication Statistics
PubMed Score  47.88

PubMed score by year
PubTator Score  89.35

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIV
1-70
TTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNN
70-140
ADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQP
140-210
DLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYL
210-280
PTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPST
280-350
HVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSA
350-420
IEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQQG
420-482
MEPWPLLLLFSLCSAGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNVRLKQGDMVDLPRPSCVTLGVPLFSHLQNEQWVDYNLKWNPDDYGGVKKIHIPSEKIWRPDLVLYNNADGDFAIVKFTKVLLQYTGHITWTPPAIFKSYCEIIVTHFPFDEQNCSMKLGTWTYDGSVVAINPESDQPDLSNFMESGEWVIKESRGWKHSVTYSCCPDTPYLDITYHFVMQRLPLYFIVNVIIPCLLFSFLTGLVFYLPTDSGEKMTLSISVLLSLTVFLLVIVELIPSTSSAVPLIGKYMLFTMVFVIASIIITVIVINTHHRSPSTHVMPNWVRKVFIDTIPNIMFFSTMKRPSREKQDKKIFTEDIDISDISGKPGPPPMGFHSPLIKHPEVKSAIEGIKYIAETMKSDQESNNAAAEWKYVAMVMDHILLGVFMLVCIIGTLAVFAGRLIELNQQG