You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
APOC3
Apolipoprotein C-III

Protein Summary
Description
Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma (PubMed:18201179, PubMed:22510806). Plays a multifaceted role in triglyceride homeostasis (PubMed:18201179, PubMed:22510806). Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs) (PubMed:18201179, PubMed:22510806). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors (PubMed:18201179, PubMed:22510806). Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners (PubMed:18408013). This gene encodes a protein component of triglyceride (TG)-rich lipoproteins (TRLs) including very low density lipoproteins (VLDL), high density lipoproteins ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000227667
  • ENSP00000227667
  • ENSG00000110245

Symbol
  • APOCIII
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
metabolite
1
biological process
0.99
biological term
0.93
co-expressed gene
0.82
disease
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 863.46   (req: < 5)
Gene RIFs: 214   (req: <= 3)
Antibodies: 379   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 863.46   (req: >= 5)
Gene RIFs: 214   (req: > 3)
Antibodies: 379   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 32
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
volanesorsen
no chemical structure image available
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (23)
Chylomicron assembly (R-HSA-8963888)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chylomicron assembly
Reactome
Chylomicron remodeling
Reactome
G alpha (i) signalling events
Reactome
GPCR downstream signalling
Reactome
HDL remodeling
Name
Explore in Pharos
Explore in Source
Chylomicron assembly
Chylomicron remodeling
G alpha (i) signalling events
GPCR downstream signalling
HDL remodeling
Protein-Protein Interactions (192)
1 – 10 of 192
ERN1
Tchem
Family: Kinase
Novelty: 0.00324545
p_int: 0.999994085
p_ni: 0.000005915
Data Source: BioPlex
PCYOX1
Tbio
Family: Enzyme
Novelty: 0.24200876
p_int: 0.999300251
p_ni: 0.000699749
Score: 0.791
Data Source: BioPlex,STRINGDB
CACNA2D1
Tclin
Family: IC
Novelty: 0.0266267
p_int: 0.998567935
p_ni: 0.001432065
Data Source: BioPlex
EMC1
Tbio
Novelty: 0.08648203
p_int: 0.996892258
p_ni: 0.003107743
Data Source: BioPlex
ALG9
Tbio
Family: Enzyme
Novelty: 0.08306637
p_int: 0.990051186
p_ni: 0.009948267
p_wrong: 5.47e-7
Data Source: BioPlex
PDIA5
Tbio
Family: Enzyme
Novelty: 0.05109703
p_int: 0.988587845
p_ni: 0.011412155
Data Source: BioPlex
POMT1
Tbio
Family: Enzyme
Novelty: 0.02417298
p_int: 0.982499625
p_ni: 0.017500375
Data Source: BioPlex
ZMPSTE24
Tbio
Family: Enzyme
Novelty: 0.00353005
p_int: 0.961131966
p_ni: 0.038677928
p_wrong: 0.000190106
Data Source: BioPlex
GLG1
Tbio
Novelty: 0.01232832
p_int: 0.941309432
p_ni: 0.058690568
Data Source: BioPlex
POMT2
Tbio
Family: Enzyme
Novelty: 0.03313606
p_int: 0.929473975
p_ni: 0.070526025
Data Source: BioPlex
Publication Statistics
PubMed Score  863.46

PubMed score by year
PubTator Score  764.8

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSL
1-70
KDYWSTVKDKFSEFWDLDPEVRPTSAVAA
70-99
MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA