You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
HLA-DRB1
HLA class II histocompatibility antigen, DRB1-3 chain

Protein Summary
Description
Binds peptides derived from antigens that access the endocytic route of antigen presenting cells (APC) and presents them on the cell surface for recognition by the CD4 T-cells. The peptide binding cleft accommodates peptides of 10-30 residues. The peptides presented by MHC class II molecules are generated mostly by degradation of proteins that access the endocytic route; where they are processed by lysosomal proteases and other hydrolases. Exogenous antigens that have been endocytosed by the APC are thus readily available for presentation via MHC II molecules; and for this reason this antigen presentation pathway is usually referred to as exogenous. As membrane proteins on their way to degradation in lysosomes as part of their normal turn-over are also contained in the endosomal/lysosomal compartments; exogenous antigens must compete with those derived from endogenous components. Autophagy is also a source of endogenous peptides; autophagosomes constitutively fuse with MHC class II loa ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000328980
  • ENSP00000331343
  • ENSG00000206306
  • ENST00000399450
  • ENSP00000382378
  • ENSG00000206240

Symbol
  • SS1
  • DRB1
  • HLA-DRB
  • HLA-DR1B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2246.73   (req: < 5)
Gene RIFs: 1105   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2246.73   (req: >= 5)
Gene RIFs: 1105   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (95)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 13
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Costimulation by the CD28 family
Reactome
Cytokine Signaling in Immune system
Reactome
Downstream TCR signaling
Reactome
Generation of second messenger molecules
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Costimulation by the CD28 family
Cytokine Signaling in Immune system
Downstream TCR signaling
Generation of second messenger molecules
Gene Ontology Terms (18)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (388)
1 – 10 of 388
HLA-DRA
Tbio
Novelty: 0.00705028
Score: 0.999
Data Source: STRINGDB
CD74
Tchem
Novelty: 0.00337387
Score: 0.998
Data Source: STRINGDB
HLA-DMA
Tbio
Novelty: 0.00278784
Score: 0.997
Data Source: STRINGDB
CD4
Tclin
Novelty: 0.00001541
Score: 0.986
Data Source: STRINGDB
HLA-DRB5
Tbio
Novelty: 0.00411779
Score: 0.98
Data Source: STRINGDB
PTPN22
Tchem
Family: Enzyme
Novelty: 0.0018748
Score: 0.98
Data Source: STRINGDB
HLA-DMB
Tbio
Novelty: 0.00537623
Score: 0.979
Data Source: STRINGDB
HLA-DPA1
Tbio
Novelty: 0.01432663
Score: 0.975
Data Source: STRINGDB
HLA-DQA1
Tbio
Novelty: 0.00059149
Score: 0.964
Data Source: STRINGDB
HLA-DQA2
Tbio
Novelty: 0.00540414
Score: 0.963
Data Source: STRINGDB
Publication Statistics
PubMed Score  2246.73

PubMed score by year
PubTator Score  4503.37

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFD
1-70
SDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQH
70-140
HNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVT
140-210
SPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS
210-266
MVCLRLPGGSCMAVLTVTLMVLSSPLALAGDTRPRFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAVTELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSPLTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPRGFLS