You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
IGHG4
Immunoglobulin heavy constant gamma 4

Protein Summary
Description
Constant region of immunoglobulin heavy chains. Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:22158414, PubMed:20176268). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affin ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000390543
  • ENSP00000374985
  • ENSG00000211892
  • ENST00000618981
  • ENSP00000483393
  • ENSG00000277016
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
tissue sample
0.49
pathway
0.47
interacting protein
0.43
tissue
0.38
disease
0.34


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (11)
1 – 5 of 11
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (14)
Classical antibody-mediated complement activation (R-HSA-173623)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 14
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Classical antibody-mediated complement activation
Reactome
Complement cascade
Reactome
Creation of C4 and C2 activators
Reactome
Cytokine Signaling in Immune system
Reactome
FCGR activation
Name
Explore in Pharos
Explore in Source
Classical antibody-mediated complement activation
Complement cascade
Creation of C4 and C2 activators
Cytokine Signaling in Immune system
FCGR activation
Protein-Protein Interactions (35)
1 – 10 of 35
ALDH2
Tclin
Family: Enzyme
Novelty: 0.00094367
p_int: 0.999994149
p_ni: 0.00000583
p_wrong: 2.1e-8
Data Source: BioPlex
RAD51AP1
Tbio
Novelty: 0.07791091
p_int: 0.998436853
p_ni: 0.000142657
p_wrong: 0.001420489
Data Source: BioPlex
SNX27
Tbio
Novelty: 0.02796021
p_int: 0.997372442
p_ni: 0.000005619
p_wrong: 0.002621939
Data Source: BioPlex
PIK3CA
Tclin
Family: Kinase
Novelty: 0.00077082
Data Source: Reactome
FCGR2A
Tbio
Novelty: 0.00116226
Data Source: Reactome
ELMO2
Tbio
Novelty: 0.08787898
Data Source: Reactome
SERPING1
Tbio
Family: Enzyme
Novelty: 0.00076515
Data Source: Reactome
C2
Tbio
Novelty: 0.01346942
Data Source: Reactome
C1QC
Tbio
Novelty: 0.04536303
Data Source: Reactome
PLCG2
Tchem
Family: Enzyme
Novelty: 0.00370802
Data Source: Reactome
Publication Statistics
PubTator Score  5.57

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVT
1-70
VPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVT
70-140
CVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPS
140-210
SIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS
210-280
DGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK
280-327
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVESKYGPPCPSCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGK