You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
TRAV8-4
T cell receptor alpha variable 8-4

Protein Summary
Description
V region of the variable domain of T cell receptor (TR) alpha chain that participates in the antigen recognition (PubMed:24600447). Alpha-beta T cell receptors are antigen specific receptors which are essential to the immune response and are present on the cell surface of T lymphocytes. Recognize peptide-major histocompatibility (MH) (pMH) complexes that are displayed by antigen presenting cells (APC), a prerequisite for efficient T cell adaptive immunity against pathogens (PubMed:25493333). Binding of alpha-beta TR to pMH complex initiates TR-CD3 clustering on the cell surface and intracellular activation of LCK that phosphorylates the ITAM motifs of CD3G, CD3D, CD3E and CD247 enabling the recruitment of ZAP70. In turn ZAP70 phosphorylates LAT, which recruits numerous signaling molecules to form the LAT signalosome. The LAT signalosome propagates signal branching to three major signaling pathways, the calcium, the mitogen-activated protein kinase (MAPK) kinase and the nuclear factor-k ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000390438
  • ENSP00000445942
  • ENSG00000211790

Symbol
  • TRAV84
  • TCRAV1S2
  • TCRAV8S4
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: < 5)
Gene RIFs: 0   (req: <= 3)
Antibodies: 0   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 0   (req: >= 5)
Gene RIFs: 0   (req: > 3)
Antibodies: 0   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (14)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Costimulation by the CD28 family
Reactome
Downstream TCR signaling
Reactome
Generation of second messenger molecules
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Costimulation by the CD28 family
Downstream TCR signaling
Generation of second messenger molecules
Immune System
Gene Ontology Terms (7)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Non-traceable Author Statement (NAS)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (35)
1 – 10 of 35
TRBC1
Tdark
Data Source: Reactome
PLCG1
Tchem
Family: Enzyme
Novelty: 0.00125418
Data Source: Reactome
CD3E
Tclin
Novelty: 0.00541492
Data Source: Reactome
CD8A
Tbio
Novelty: 0.00003113
Data Source: Reactome
CSK
Tchem
Family: Kinase
Novelty: 0.00233206
Data Source: Reactome
LAT
Tbio
Novelty: 0.00738606
Data Source: Reactome
HLA-DQA1
Tbio
Novelty: 0.00059149
Data Source: Reactome
TRBV12-3
Tdark
Data Source: Reactome
PTPRJ
Tbio
Family: Enzyme
Novelty: 0.00998711
Data Source: Reactome
CD1A
Tbio
Novelty: 0.00133941
Data Source: Reactome
Publication Statistics
Amino Acid Sequence
Residue Counts
Sequence
MLLLLVPVLEVIFTLGGTRAQSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYT
1-70
SAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVS
70-113
MLLLLVPVLEVIFTLGGTRAQSVTQLGSHVSVSEGALVLLRCNYSSSVPPYLFWYVQYPNQGLQLLLKYTSAATLVKGINGFEAEFKKSETSFHLTKPSAHMSDAAEYFCAVS