You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
IL2RA
Interleukin-2 receptor subunit alpha

Protein Summary
Description
Receptor for interleukin-2. The receptor is involved in the regulation of immune tolerance by controlling regulatory T cells (TREGs) activity. TREGs suppress the activation and expansion of autoreactive T-cells. The interleukin 2 (IL2) receptor alpha (IL2RA) and beta (IL2RB) chains, together with the common gamma chain (IL2RG), constitute the high-affinity IL2 receptor. Homodimeric alpha chains (IL2RA) result in low-affinity receptor, while homodimeric beta (IL2RB) chains produce a medium-affinity receptor. Normally an integral-membrane protein, soluble IL2RA has been isolated and determined to result from extracellular proteolyisis. Alternately-spliced IL2RA mRNAs have been isolated, but the significance of each is presently unknown. Mutations in this gene are associated with interleukin 2 receptor alpha deficiency.[provided by RefSeq, Nov 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000379959
  • ENSP00000369293
  • ENSG00000134460

Symbol
  • p55
  • CD25
  • IL2R
  • IMD41
  • TCGFR
  • IDDM10
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease
0.96
trait
0.93
biological process
0.79
chemical
0.79
phenotype
0.77


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 984.64   (req: < 5)
Gene RIFs: 367   (req: <= 3)
Antibodies: 2753   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 984.64   (req: >= 5)
Gene RIFs: 367   (req: > 3)
Antibodies: 2753   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 22
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 4
Protein Data Bank (7)
1 – 5 of 7
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (209)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 18
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
FLT3 Signaling
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
FLT3 Signaling
Gene expression (Transcription)
Generic Transcription Pathway
Immune System
Protein-Protein Interactions (320)
1 – 10 of 320
IL2
Tchem
Novelty: 0.00004362
Score: 0.999
Data Source: Reactome,STRINGDB
IL2RB
Tclin
Novelty: 0.00753505
Score: 0.996
Data Source: Reactome,STRINGDB
IL2RG
Tclin
Novelty: 0.00155443
Score: 0.994
Data Source: Reactome,STRINGDB
STAT5B
Tchem
Family: TF
Novelty: 0.00091216
Score: 0.987
Data Source: STRINGDB
FOXP3
Tbio
Family: TF
Novelty: 0.00020363
Score: 0.984
Data Source: STRINGDB
STAT5A
Tchem
Family: TF
Novelty: 0.00091229
Score: 0.979
Data Source: STRINGDB
CSF2
Tbio
Novelty: 0.00012299
Score: 0.977
Data Source: STRINGDB
JAK3
Tclin
Family: Kinase
Novelty: 0.00219647
Score: 0.967
Data Source: Reactome,STRINGDB
STAT3
Tchem
Family: TF
Novelty: 0.00013496
Score: 0.966
Data Source: STRINGDB
IL5
Tclin
Novelty: 0.00032832
Score: 0.965
Data Source: STRINGDB
Publication Statistics
PubMed Score  984.64

PubMed score by year
PubTator Score  3767.12

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGN
1-70
SSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIY
70-140
HFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESE
140-210
TSCLVTTTDFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
210-272
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKSGSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQASLPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQPQLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQVAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI