Protein Summary
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
- ENST00000610521
- ENSP00000484479
- ENSG00000147873
- INA5
- INFA5
- leIF G
- IFN-alphaG
- IFN-alpha-5
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
biological process | 0.82 | ||
tissue sample | 0.74 | ||
cell type or tissue | 0.62 | ||
pathway | 0.52 | ||
phenotype | 0.51 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 51.56 (req: < 5)
Gene RIFs: 6 (req: <= 3)
Antibodies: 197 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 51.56 (req: >= 5)
Gene RIFs: 6 (req: > 3)
Antibodies: 197 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 15
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Pathways (85)
Reactome (10)
KEGG (22)
PathwayCommons (12)
WikiPathways (41)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 10
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Cytokine Signaling in Immune system | ||||
Reactome | DDX58/IFIH1-mediated induction of interferon-alpha/beta | ||||
Reactome | Factors involved in megakaryocyte development and platelet production | ||||
Reactome | Hemostasis | ||||
Reactome | Immune System | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Cytokine Signaling in Immune system | ||||
DDX58/IFIH1-mediated induction of interferon-alpha/beta | ||||
Factors involved in megakaryocyte development and platelet production | ||||
Hemostasis | ||||
Immune System | ||||
Gene Ontology Terms (17)
Functions (3)
Components (2)
Processes (12)
Items per page:
10
1 – 3 of 3
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Inferred from Biological aspect of Ancestor (IBA) | GO_Central | |||
Traceable Author Statement (TAS) | ProtInc | |||
Protein-Protein Interactions (62)
1 – 10 of 62
IFNA6
Novelty: 0.07133637
p_int: 0.999999792
p_ni: 1.99e-7
p_wrong: 1e-8
Score: 0.852
Data Source: BioPlex,STRINGDB
IFNA4
Novelty: 0.06891704
p_int: 0.99999941
p_ni: 5.9e-7
Score: 0.833
Data Source: BioPlex,STRINGDB
IFNA17
Novelty: 0.00468841
p_int: 0.999995972
p_ni: 7.1e-8
p_wrong: 0.000003958
Score: 0.296
Data Source: BioPlex,STRINGDB
IFNA14
Novelty: 0.42599235
p_int: 0.999973778
p_ni: 0.000026008
p_wrong: 2.14e-7
Score: 0.873
Data Source: BioPlex,STRINGDB
IFNA1
Novelty: 0.00013873
p_int: 0.999876354
p_ni: 0.000123646
Data Source: BioPlex
SURF1
Novelty: 0.00865786
p_int: 0.999801713
p_ni: 0.000197778
p_wrong: 5.09e-7
Score: 0.228
Data Source: BioPlex,STRINGDB
ISG15
Novelty: 0.00256125
p_int: 0.999739268
p_ni: 0.000202887
p_wrong: 0.000057845
Score: 0.886
Data Source: BioPlex,STRINGDB
IFNA2
Novelty: 0.00041727
p_int: 0.999497914
p_wrong: 0.000502085
Score: 0.861
Data Source: BioPlex,STRINGDB
IFIT1
Novelty: 0.00862855
p_int: 0.997622525
p_ni: 0.00232999
p_wrong: 0.000047485
Score: 0.772
Data Source: BioPlex,STRINGDB
UBR3
Family: Enzyme
Novelty: 0.11338583
p_int: 0.99742976
p_ni: 0.00257024
Score: 0.217
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score 51.56
PubMed score by year
PubTator Score 34.73
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQ
1-70
FQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSI
70-140
LTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
140-189
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
Find similar targets by: