You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IFNA5
Interferon alpha-5

Protein Summary
Description
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000610521
  • ENSP00000484479
  • ENSG00000147873

Symbol
  • INA5
  • INFA5
  • leIF G
  • IFN-alphaG
  • IFN-alpha-5
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.82
tissue sample
0.74
cell type or tissue
0.62
pathway
0.52
phenotype
0.51


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 51.56   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 197   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 51.56   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 197   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (85)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
DDX58/IFIH1-mediated induction of interferon-alpha/beta
Reactome
Factors involved in megakaryocyte development and platelet production
Reactome
Hemostasis
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
DDX58/IFIH1-mediated induction of interferon-alpha/beta
Factors involved in megakaryocyte development and platelet production
Hemostasis
Immune System
Protein-Protein Interactions (62)
1 – 10 of 62
IFNA6
Tbio
Novelty: 0.07133637
p_int: 0.999999792
p_ni: 1.99e-7
p_wrong: 1e-8
Score: 0.852
Data Source: BioPlex,STRINGDB
IFNA4
Tbio
Novelty: 0.06891704
p_int: 0.99999941
p_ni: 5.9e-7
Score: 0.833
Data Source: BioPlex,STRINGDB
IFNA17
Tbio
Novelty: 0.00468841
p_int: 0.999995972
p_ni: 7.1e-8
p_wrong: 0.000003958
Score: 0.296
Data Source: BioPlex,STRINGDB
IFNA14
Tbio
Novelty: 0.42599235
p_int: 0.999973778
p_ni: 0.000026008
p_wrong: 2.14e-7
Score: 0.873
Data Source: BioPlex,STRINGDB
IFNA1
Tbio
Novelty: 0.00013873
p_int: 0.999876354
p_ni: 0.000123646
Data Source: BioPlex
SURF1
Tbio
Novelty: 0.00865786
p_int: 0.999801713
p_ni: 0.000197778
p_wrong: 5.09e-7
Score: 0.228
Data Source: BioPlex,STRINGDB
ISG15
Tbio
Novelty: 0.00256125
p_int: 0.999739268
p_ni: 0.000202887
p_wrong: 0.000057845
Score: 0.886
Data Source: BioPlex,STRINGDB
IFNA2
Tbio
Novelty: 0.00041727
p_int: 0.999497914
p_wrong: 0.000502085
Score: 0.861
Data Source: BioPlex,STRINGDB
IFIT1
Tbio
Novelty: 0.00862855
p_int: 0.997622525
p_ni: 0.00232999
p_wrong: 0.000047485
Score: 0.772
Data Source: BioPlex,STRINGDB
UBR3
Tbio
Family: Enzyme
Novelty: 0.11338583
p_int: 0.99742976
p_ni: 0.00257024
Score: 0.217
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  51.56

PubMed score by year
PubTator Score  34.73

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQ
1-70
FQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSI
70-140
LTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
140-189
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE