You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IFNA10
Interferon alpha-10

Protein Summary
Description
Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. This gene encodes a protein that belongs to the type I interferon family of proteins, and is located in a cluster of alpha interferon genes on chromosome 9. Interferons are small regulatory molecules that function in cell signaling in response to viruses and other pathogens or tumor cells. This gene is intronless and the encoded protein is secreted. [provided by RefSeq, Aug 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000357374
  • ENSP00000369566
  • ENSG00000186803

Symbol
  • IFN-alphaC
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
0.91
biological process
0.82
cell line
0.56
virus perturbation
0.55
pathway
0.52


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.51   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 174   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 16.51   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 174   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (90)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 10
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
DDX58/IFIH1-mediated induction of interferon-alpha/beta
Reactome
Factors involved in megakaryocyte development and platelet production
Reactome
Hemostasis
Reactome
Immune System
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
DDX58/IFIH1-mediated induction of interferon-alpha/beta
Factors involved in megakaryocyte development and platelet production
Hemostasis
Immune System
Gene Ontology Terms (16)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (81)
1 – 10 of 81
ISG15
Tbio
Novelty: 0.00256125
p_int: 0.999863743
p_ni: 0.000136255
p_wrong: 2e-9
Score: 0.228
Data Source: BioPlex,STRINGDB
IFIT1
Tbio
Novelty: 0.00862855
p_int: 0.999111822
p_ni: 0.000697794
p_wrong: 0.000190384
Score: 0.354
Data Source: BioPlex,STRINGDB
UBR3
Tbio
Family: Enzyme
Novelty: 0.11338583
p_int: 0.980595177
p_ni: 0.019404823
Score: 0.188
Data Source: BioPlex,STRINGDB
IFNA7
Tdark
Novelty: 0.19189765
Score: 0.927
Data Source: STRINGDB
IFNA16
Tdark
Novelty: 0.57931034
Score: 0.919
Data Source: STRINGDB
IRF7
Tbio
Family: TF
Novelty: 0.00308898
Score: 0.917
Data Source: STRINGDB
IFNA17
Tbio
Novelty: 0.00468841
Score: 0.917
Data Source: STRINGDB
IFNAR1
Tclin
Novelty: 0.00224149
Score: 0.917
Data Source: STRINGDB
IFNA4
Tbio
Novelty: 0.06891704
Score: 0.912
Data Source: STRINGDB
IFNAR2
Tclin
Novelty: 0.00573978
Score: 0.912
Data Source: STRINGDB
Publication Statistics
PubMed Score  16.51

PubMed score by year
PubTator Score  16.94

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQ
1-70
FQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSI
70-140
LAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD
140-189
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLEACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTNLQKRLRRKD