Protein Classes
Protein Summary
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo. The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4, myocardial infarction, non-Hodgkin's lymphoma, and psoriatic arthritis. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]
- ENST00000412851
- ENSP00000412555
- ENSG00000230279
- ENST00000418386
- ENSP00000413450
- ENSG00000226979
- ENST00000426845
- ENSP00000402413
- ENST00000436519
- ENSP00000395976
- ENSG00000231408
- ENST00000454550
- ENSP00000416509
- ENST00000454783
- ENSP00000403495
- TNFB
- TNFSF1
- LT
- TNFB
- TNFSF1
- TNLG1E
Most Knowledge About | Knowledge Value
(0 to 1 scale) | ||
---|---|---|---|
biological term | 0.94 | ||
disease | 0.94 | ||
phenotype | 0.9 | ||
biological process | 0.87 | ||
cell type or tissue | 0.83 | ||
IDG Development Level Summary
These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 703.11 (req: < 5)
Gene RIFs: 221 (req: <= 3)
Antibodies: 701 (req: <= 50)
These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:
Pubmed score: 703.11 (req: >= 5)
Gene RIFs: 221 (req: > 3)
Antibodies: 701 (req: > 50)
- OR - satisfy the following criterion:
Gene Ontology Terms: 21
Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions
Active Ligand: 0
Target has at least one approved drug - AND - satisfies the preceding conditions
Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id | Ligand | Method | Resolution (Ã…) | M.W. (kDa) | Pub Year | Title |
---|
PDB Structure Id | M.W. | Resolution | Pub Year |
---|
Pathways (53)
Reactome (5)
KEGG (7)
PathwayCommons (10)
WikiPathways (31)
Click on a row in the table to change the structure displayed.
Items per page:
1 – 5 of 5
Data Source | Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|---|
Reactome | Cytokine Signaling in Immune system | ||||
Reactome | Immune System | ||||
Reactome | TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway | ||||
Reactome | TNFR2 non-canonical NF-kB pathway | ||||
Reactome | TNFs bind their physiological receptors | ||||
Name | Explore in Pharos | Explore in Source | ||
---|---|---|---|---|
Cytokine Signaling in Immune system | ||||
Immune System | ||||
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway | ||||
TNFR2 non-canonical NF-kB pathway | ||||
TNFs bind their physiological receptors | ||||
Gene Ontology Terms (23)
Functions (3)
Components (2)
Processes (18)
Items per page:
10
1 – 3 of 3
GO Term | Evidence | Assigned by | ||
---|---|---|---|---|
Traceable Author Statement (TAS) | ProtInc | |||
Inferred from Electronic Annotation (IEA) | UniProtKB-KW | |||
Inferred from Electronic Annotation (IEA) | InterPro | |||
Protein-Protein Interactions (207)
1 – 10 of 207
ANKRD40
p_int: 0.956792251
p_ni: 0.043207749
Score: 0.282
Data Source: BioPlex,STRINGDB
TNFRSF1A
Novelty: 0.00048442
Score: 0.997
Data Source: Reactome,STRINGDB
LTBR
Novelty: 0.00438925
Score: 0.996
Data Source: Reactome,STRINGDB
LTB
Novelty: 0.00638186
Score: 0.992
Data Source: Reactome,STRINGDB
TNFRSF14
Novelty: 0.00387753
Score: 0.978
Data Source: Reactome,STRINGDB
TNFRSF1B
Novelty: 0.00019286
Score: 0.977
Data Source: Reactome,STRINGDB
TNF
Novelty: 0.00001974
Score: 0.961
Data Source: STRINGDB
CD40LG
Novelty: 0.00002272
Score: 0.948
Data Source: STRINGDB
TNFSF14
Novelty: 0.01266766
Score: 0.945
Data Source: STRINGDB
TNFSF11
Novelty: 0.00023862
Score: 0.941
Data Source: STRINGDB
Publication Statistics
PubMed Score 703.11
PubMed score by year
PubTator Score 695.85
PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGD
1-70
PSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSS
70-140
QYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
140-205
MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
Find similar targets by: