You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
LTA
Lymphotoxin-alpha

Protein Summary
Description
Cytokine that in its homotrimeric form binds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM. In its heterotrimeric form with LTB binds to TNFRSF3/LTBR. Lymphotoxin is produced by lymphocytes and cytotoxic for a wide range of tumor cells in vitro and in vivo. The encoded protein, a member of the tumor necrosis factor family, is a cytokine produced by lymphocytes. The protein is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. This protein also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis. Genetic variations in this gene are associated with susceptibility to leprosy type 4, myocardial infarction, non-Hodgkin's lymphoma, and psoriatic arthritis. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Jul 2012]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000412851
  • ENSP00000412555
  • ENSG00000230279
  • ENST00000418386
  • ENSP00000413450
  • ENSG00000226979
  • ENST00000426845
  • ENSP00000402413
  • ENST00000436519
  • ENSP00000395976
  • ENSG00000231408
  • ENST00000454550
  • ENSP00000416509
  • ENST00000454783
  • ENSP00000403495

Symbol
  • TNFB
  • TNFSF1
  • LT
  • TNFB
  • TNFSF1
  • TNLG1E
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
0.94
disease
0.94
phenotype
0.9
biological process
0.87
cell type or tissue
0.83


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 703.11   (req: < 5)
Gene RIFs: 221   (req: <= 3)
Antibodies: 701   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 703.11   (req: >= 5)
Gene RIFs: 221   (req: > 3)
Antibodies: 701   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 21
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (53)
Cytokine Signaling in Immune system (R-HSA-1280215)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cytokine Signaling in Immune system
Reactome
Immune System
Reactome
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
Reactome
TNFR2 non-canonical NF-kB pathway
Reactome
TNFs bind their physiological receptors
Name
Explore in Pharos
Explore in Source
Cytokine Signaling in Immune system
Immune System
TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway
TNFR2 non-canonical NF-kB pathway
TNFs bind their physiological receptors
Protein-Protein Interactions (207)
1 – 10 of 207
ANKRD40
Tdark
p_int: 0.956792251
p_ni: 0.043207749
Score: 0.282
Data Source: BioPlex,STRINGDB
TNFRSF1A
Tchem
Novelty: 0.00048442
Score: 0.997
Data Source: Reactome,STRINGDB
LTBR
Tbio
Novelty: 0.00438925
Score: 0.996
Data Source: Reactome,STRINGDB
LTB
Tbio
Novelty: 0.00638186
Score: 0.992
Data Source: Reactome,STRINGDB
TNFRSF14
Tbio
Novelty: 0.00387753
Score: 0.978
Data Source: Reactome,STRINGDB
TNFRSF1B
Tbio
Novelty: 0.00019286
Score: 0.977
Data Source: Reactome,STRINGDB
TNF
Tclin
Novelty: 0.00001974
Score: 0.961
Data Source: STRINGDB
CD40LG
Tbio
Novelty: 0.00002272
Score: 0.948
Data Source: STRINGDB
TNFSF14
Tbio
Novelty: 0.01266766
Score: 0.945
Data Source: STRINGDB
TNFSF11
Tclin
Novelty: 0.00023862
Score: 0.941
Data Source: STRINGDB
Publication Statistics
PubMed Score  703.11

PubMed score by year
PubTator Score  695.85

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGD
1-70
PSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSS
70-140
QYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
140-205
MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL