You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
FOS
Proto-oncogene c-Fos

Protein Summary
Description
Nuclear phosphoprotein which forms a tight but non-covalently linked complex with the JUN/AP-1 transcription factor. In the heterodimer, FOS and JUN/AP-1 basic regions each seems to interact with symmetrical DNA half sites. On TGF-beta activation, forms a multimeric SMAD3/SMAD4/JUN/FOS complex at the AP1/SMAD-binding site to regulate TGF-beta-mediated signaling. Has a critical function in regulating the development of cells destined to form and maintain the skeleton. It is thought to have an important role in signal transduction, cell proliferation and differentiation. In growing cells, activates phospholipid synthesis, possibly by activating CDS1 and PI4K2A. This activity requires Tyr-dephosphorylation and association with the endoplasmic reticulum. The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000303562
  • ENSP00000306245
  • ENSG00000170345
  • ENST00000535987
  • ENSP00000442268
  • ENST00000555686
  • ENSP00000452590

Symbol
  • G0S7
  • p55
  • AP-1
  • C-FOS
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
chemical
1
gene perturbation
1
hub protein
1
virus perturbation
1


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13981.79   (req: < 5)
Gene RIFs: 226   (req: <= 3)
Antibodies: 1561   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 13981.79   (req: >= 5)
Gene RIFs: 226   (req: > 3)
Antibodies: 1561   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 46
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (223)
Activation of the AP-1 family of transcription factors (R-HSA-450341)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 43
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Activation of the AP-1 family of transcription factors
Reactome
Cellular Senescence
Reactome
Cellular responses to external stimuli
Reactome
Cellular responses to stress
Reactome
Cytokine Signaling in Immune system
Name
Explore in Pharos
Explore in Source
Activation of the AP-1 family of transcription factors
Cellular Senescence
Cellular responses to external stimuli
Cellular responses to stress
Cytokine Signaling in Immune system
Gene Ontology Terms (54)
Items per page:
10
1 – 10 of 11
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
CAFA
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Physical Interaction (IPI)
CAFA
Inferred from Physical Interaction (IPI)
ParkinsonsUK-UCL
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (690)
1 – 10 of 690
JUNB
Tbio
Family: TF
Novelty: 0.01119828
p_int: 0.99999998
p_ni: 1.8e-8
p_wrong: 1e-9
Score: 0.999
Data Source: BioPlex,STRINGDB
ATF2
Tbio
Family: TF
Novelty: 0.00562547
p_int: 0.999999465
p_ni: 5.35e-7
Score: 0.986
Data Source: BioPlex,STRINGDB
ATF7
Tbio
Family: TF
Novelty: 0.01433182
p_int: 0.999999462
p_ni: 5.38e-7
Score: 0.891
Data Source: BioPlex,STRINGDB
JUND
Tbio
Family: TF
Novelty: 0.00337776
p_int: 0.999999156
p_ni: 8.44e-7
Score: 0.999
Data Source: BioPlex,STRINGDB
CREB5
Tbio
Family: TF
Novelty: 0.09663345
p_int: 0.999997489
p_ni: 0.000002506
p_wrong: 5e-9
Score: 0.896
Data Source: BioPlex,STRINGDB
JUN
Tchem
Family: TF
Novelty: 0.00013623
p_int: 0.9999958
p_ni: 0.0000042
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
STK40
Tbio
Family: Kinase
Novelty: 0.12287289
p_int: 0.999988466
p_ni: 0.000011534
Score: 0.827
Data Source: BioPlex,STRINGDB
DET1
Tbio
Novelty: 0.01807423
p_int: 0.999959433
p_ni: 0.000040564
p_wrong: 3e-9
Score: 0.873
Data Source: BioPlex,STRINGDB
COP1
Tbio
Family: Enzyme
Novelty: 0.28704864
p_int: 0.998406822
p_ni: 0.001593113
p_wrong: 6.5e-8
Score: 0.738
Data Source: BioPlex,STRINGDB
VARS
Tchem
Family: Enzyme
Novelty: 0.00662364
p_int: 0.894856956
p_ni: 0.105143044
Score: 0.303
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  13981.79

PubMed score by year
PubTator Score  4007.16

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTS
1-70
PDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKR
70-140
RIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDL
140-210
GFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRP
210-280
SGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADS
280-350
FPSCAAAHRKGSSSNEPSSDSLSSPTLLAL
350-380
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYAADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLAL