You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CST3
Cystatin-C

Protein Summary
Description
As an inhibitor of cysteine proteinases, this protein is thought to serve an important physiological role as a local regulator of this enzyme activity. The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions, where they appear to provide protective functions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes the most abundant extracellular inhibitor of cysteine proteases, which is found in high concentrations in biological fluids and is expressed in virt ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000376925
  • ENSP00000366124
  • ENSG00000101439
  • ENST00000398409
  • ENSP00000381446
  • ENST00000398411
  • ENSP00000381448

Symbol
  • ARMD11
  • HEL-S-2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological term
1
PubMedID
0.98
disease perturbation
0.9
kinase perturbation
0.88
gene perturbation
0.78


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3600.66   (req: < 5)
Gene RIFs: 430   (req: <= 3)
Antibodies: 1243   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3600.66   (req: >= 5)
Gene RIFs: 430   (req: > 3)
Antibodies: 1243   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (9)
1 – 5 of 9
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (69)
Amyloid fiber formation (R-HSA-977225)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Amyloid fiber formation
Reactome
Immune System
Reactome
Innate Immune System
Reactome
Metabolism of proteins
Reactome
Neutrophil degranulation
Name
Explore in Pharos
Explore in Source
Amyloid fiber formation
Immune System
Innate Immune System
Metabolism of proteins
Neutrophil degranulation
Protein-Protein Interactions (235)
1 – 10 of 235
DDX31
Tbio
Family: Enzyme
Novelty: 4
p_int: 0.950121091
p_ni: 0.049878896
p_wrong: 1.2e-8
Score: 0.189
Data Source: BioPlex,STRINGDB
CSTB
Tbio
Novelty: 0.00153055
Score: 0.979
Data Source: STRINGDB
ALB
Tchem
Novelty: 0.0000092
Score: 0.978
Data Source: STRINGDB
B2M
Tbio
Novelty: 0.00012184
Score: 0.973
Data Source: STRINGDB
CTSD
Tchem
Family: Enzyme
Novelty: 0.0003299
Score: 0.972
Data Source: STRINGDB
CTSS
Tchem
Family: Enzyme
Novelty: 0.00788672
Score: 0.96
Data Source: STRINGDB
APOE
Tbio
Novelty: 0.0000621
Score: 0.959
Data Source: STRINGDB
IL6
Tclin
Novelty: 0.00002829
Score: 0.956
Data Source: STRINGDB
APP
Tchem
Novelty: 0.00011446
Score: 0.956
Data Source: STRINGDB
FGF23
Tclin
Novelty: 0.00057077
Score: 0.955
Data Source: STRINGDB
Publication Statistics
PubMed Score  3600.66

PubMed score by year
PubTator Score  3557.03

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHS
1-70
RALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSK
70-140
STCQDA
140-146
MAGPLRAPLLLLAILAVALAVSPAAGSSPGKPPRLVGGPMDASVEEEGVRRALDFAVGEYNKASNDMYHSRALQVVRARKQIVAGVNYFLDVELGRTTCTKTQPNLDNCPFHDQPHLKRKAFCSFQIYAVPWQGTMTLSKSTCQDA