You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
ADA
Adenosine deaminase

Protein Summary
Description
Catalyzes the hydrolytic deamination of adenosine and 2-deoxyadenosine (PubMed:8452534, PubMed:16670267). Plays an important role in purine metabolism and in adenosine homeostasis. Modulates signaling by extracellular adenosine, and so contributes indirectly to cellular signaling events. Acts as a positive regulator of T-cell coactivation, by binding DPP4 (PubMed:20959412). Its interaction with DPP4 regulates lymphocyte-epithelial cell adhesion (PubMed:11772392). Enhances dendritic cell immunogenicity by affecting dendritic cell costimulatory molecule expression and cytokines and chemokines secretion (By similarity). Enhances CD4+ T-cell differentiation and proliferation (PubMed:20959412). Acts as a positive modulator of adenosine receptors ADORA1 and ADORA2A, by enhancing their ligand affinity via conformational change (PubMed:23193172). Stimulates plasminogen activation (PubMed:15016824). Plays a role in male fertility (PubMed:21919946, PubMed:26166670). Plays a protective role in ea ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000372874
  • ENSP00000361965
  • ENSG00000196839

Symbol
  • ADA1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
biological term
0.91
gene perturbation
0.91
disease
0.89
disease perturbation
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 921.01   (req: < 5)
Gene RIFs: 144   (req: <= 3)
Antibodies: 460   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 921.01   (req: >= 5)
Gene RIFs: 144   (req: > 3)
Antibodies: 460   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 44
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 38
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
pentostatin
chemical structure image
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (51)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of nucleotides
Reactome
Nucleotide salvage
Reactome
Purine salvage
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of nucleotides
Nucleotide salvage
Purine salvage
Protein-Protein Interactions (236)
1 – 10 of 236
POTEF
Tbio
Novelty: 0.01093698
p_int: 0.999668142
p_ni: 0.000331856
p_wrong: 2e-9
Score: 0.602
Data Source: BioPlex,STRINGDB
ACTBL2
Tbio
Novelty: 0.35273907
p_int: 0.788085563
p_ni: 0.211914437
Score: 0.249
Data Source: BioPlex,STRINGDB
ADK
Tchem
Family: Kinase
Novelty: 0.00282266
Score: 0.997
Data Source: STRINGDB
PNP
Tclin
Family: Enzyme
Novelty: 0.00222396
Score: 0.996
Data Source: STRINGDB
NT5E
Tchem
Family: Enzyme
Novelty: 0.00121213
Score: 0.971
Data Source: STRINGDB
DCK
Tchem
Family: Kinase
Novelty: 0.00236412
Score: 0.962
Data Source: STRINGDB
ADA2
Tbio
Family: Enzyme
Novelty: 0.01375983
Score: 0.945
Data Source: STRINGDB
NT5C2
Tbio
Family: Enzyme
Novelty: 0.00549174
Score: 0.935
Data Source: STRINGDB
ADAR
Tbio
Family: Enzyme
Novelty: 0.00122438
Score: 0.929
Data Source: STRINGDB
NT5C1A
Tbio
Family: Enzyme
Novelty: 0.00639986
Score: 0.921
Data Source: STRINGDB
Publication Statistics
PubMed Score  921.01

PubMed score by year
PubTator Score  3142.13

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMP
1-70
AIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEG
70-140
ERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAIDLAGDETIPGSSLLPGHVQAYQEAVKSGIH
140-210
RTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAV
210-280
IRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKA
280-350
YGMPPSASAGQNL
350-363
MAQTPAFDKPKVELHVHLDGSIKPETILYYGRRRGIALPANTAEGLLNVIGMDKPLTLPDFLAKFDYYMPAIAGCREAIKRIAYEFVEMKAKEGVVYVEVRYSPHLLANSKVEPIPWNQAEGDLTPDEVVALVGQGLQEGERDFGVKARSILCCMRHQPNWSPKVVELCKKYQQQTVVAIDLAGDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEEFKRLNINAAKSSFLPEDEKRELLDLLYKAYGMPPSASAGQNL