You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
F9
Coagulation factor IX

Protein Classes
Protein Summary
Description
Factor IX is a vitamin K-dependent plasma protein that participates in the intrinsic pathway of blood coagulation by converting factor X to its active form in the presence of Ca(2+) ions, phospholipids, and factor VIIIa. This gene encodes vitamin K-dependent coagulation factor IX that circulates in the blood as an inactive zymogen. This factor is converted to an active form by factor XIa, which excises the activation peptide and thus generates a heavy chain and a light chain held together by one or more disulfide bonds. The role of this activated factor IX in the blood coagulation cascade is to activate factor X to its active form through interactions with Ca+2 ions, membrane phospholipids, and factor VIII. Alterations of this gene, including point mutations, insertions and deletions, cause factor IX deficiency, which is a recessive X-linked disorder, also called hemophilia B or Christmas disease. Alternative splicing results in multiple transcript variants encoding different isoforms ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000218099
  • ENSP00000218099
  • ENSG00000101981
  • ENST00000394090
  • ENSP00000377650

Symbol
  • FIX
  • P19
  • PTC
  • HEMB
  • THPH8
  • F9 p22
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
1
disease perturbation
0.74
kinase perturbation
0.71
cell type or tissue
0.66
cellular component
0.65


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3478.23   (req: < 5)
Gene RIFs: 152   (req: <= 3)
Antibodies: 707   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3478.23   (req: >= 5)
Gene RIFs: 152   (req: > 3)
Antibodies: 707   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 8
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 463
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (38)
1 – 5 of 38
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (19)
Extrinsic Pathway of Fibrin Clot Formation (R-HSA-140834)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Extrinsic Pathway of Fibrin Clot Formation
Reactome
Formation of Fibrin Clot (Clotting Cascade)
Reactome
Gamma carboxylation, hypusine formation and arylsulfatase activation
Reactome
Gamma-carboxylation of protein precursors
Reactome
Gamma-carboxylation, transport, and amino-terminal cleavage of proteins
Name
Explore in Pharos
Explore in Source
Extrinsic Pathway of Fibrin Clot Formation
Formation of Fibrin Clot (Clotting Cascade)
Gamma carboxylation, hypusine formation and arylsulfatase activation
Gamma-carboxylation of protein precursors
Gamma-carboxylation, transport, and amino-terminal cleavage of proteins
Protein-Protein Interactions (153)
1 – 10 of 153
FERMT2
Tbio
Novelty: 0.01142925
p_int: 0.999971077
p_ni: 0.000028923
Data Source: BioPlex
MIB2
Tbio
Family: Enzyme
Novelty: 0.0194052
p_int: 0.99996177
p_ni: 0.000038228
p_wrong: 1e-9
Score: 0.184
Data Source: BioPlex,STRINGDB
RBM14
Tbio
Novelty: 0.00695569
p_int: 0.99848729
p_ni: 0.001512315
p_wrong: 3.95e-7
Data Source: BioPlex
DCP2
Tbio
Family: Enzyme
Novelty: 0.00984421
p_int: 0.998073052
p_ni: 0.001926936
p_wrong: 1.2e-8
Data Source: BioPlex
MCM8
Tbio
Family: Enzyme
Novelty: 0.03119431
p_int: 0.990904251
p_ni: 0.009095749
Data Source: BioPlex
FIGNL1
Tbio
Family: Enzyme
Novelty: 0.12790427
p_int: 0.9864708
p_ni: 0.005221771
p_wrong: 0.008307429
Score: 0.161
Data Source: BioPlex,STRINGDB
SETD2
Tchem
Family: Epigenetic
Novelty: 0.00129405
p_int: 0.978801272
p_ni: 0.021198728
Data Source: BioPlex
EOGT
Tbio
Family: Enzyme
Novelty: 0.17308881
p_int: 0.97227274
p_ni: 0.007065957
p_wrong: 0.020661304
Data Source: BioPlex
ACOT9
Tdark
Family: Enzyme
Novelty: 0.73972603
p_int: 0.950117745
p_ni: 0.049882251
p_wrong: 4e-9
Score: 0.163
Data Source: BioPlex,STRINGDB
ZNHIT6
Tbio
Novelty: 3
p_int: 0.945521294
p_ni: 0.054478696
p_wrong: 1e-8
Data Source: BioPlex
Publication Statistics
PubMed Score  3478.23

PubMed score by year
PubTator Score  3869.35

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNLERECMEEKCS
1-70
FEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGR
70-140
CEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETI
140-210
LDNITQSTQSFNDFTRVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAG
210-280
EHNIEETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGS
280-350
GYVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVE
350-420
GTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT
420-461
MQRVNMIMAESPGLITICLLGYLLSAECTVFLDHENANKILNRPKRYNSGKLEEFVQGNLERECMEEKCSFEEAREVFENTERTTEFWKQYVDGDQCESNPCLNGGSCKDDINSYECWCPFGFEGKNCELDVTCNIKNGRCEQFCKNSADNKVVCSCTEGYRLAENQKSCEPAVPFPCGRVSVSQTSKLTRAETVFPDVDYVNSTEAETILDNITQSTQSFNDFTRVVGGEDAKPGQFPWQVVLNGKVDAFCGGSIVNEKWIVTAAHCVETGVKITVVAGEHNIEETEHTEQKRNVIRIIPHHNYNAAINKYNHDIALLELDEPLVLNSYVTPICIADKEYTNIFLKFGSGYVSGWGRVFHKGRSALVLQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQGDSGGPHVTEVEGTSFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKEKTKLT