You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
ALDH1A1
Retinal dehydrogenase 1

Protein Summary
Description
Can convert/oxidize retinaldehyde to retinoic acid. Binds free retinal and cellular retinol-binding protein-bound retinal (By similarity). May have a broader specificity and oxidize other aldehydes in vivo (PubMed:19296407, PubMed:26373694, PubMed:25450233). The protein encoded by this gene belongs to the aldehyde dehydrogenase family. Aldehyde dehydrogenase is the next enzyme after alcohol dehydrogenase in the major pathway of alcohol metabolism. There are two major aldehyde dehydrogenase isozymes in the liver, cytosolic and mitochondrial, which are encoded by distinct genes, and can be distinguished by their electrophoretic mobility, kinetic properties, and subcellular localization. This gene encodes the cytosolic isozyme. Studies in mice show that through its role in retinol metabolism, this gene may also be involved in the regulation of the metabolic responses to high-fat diet. [provided by RefSeq, Mar 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000297785
  • ENSP00000297785
  • ENSG00000165092

Symbol
  • ALDC
  • ALDH1
  • PUMB1
  • ALDC
  • ALDH1
  • HEL-9
  • HEL12
  • PUMB1
  • ALDH11
  • RALDH1
  • ALDH-E1
  • HEL-S-53e
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.97
transcription factor perturbation
0.94
gene perturbation
0.92
biological term
0.91
protein domain
0.85


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 697.12   (req: < 5)
Gene RIFs: 262   (req: <= 3)
Antibodies: 956   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 697.12   (req: >= 5)
Gene RIFs: 262   (req: > 3)
Antibodies: 956   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 13
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 21
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (10)
1 – 5 of 10
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (29)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 11
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Ethanol oxidation
Reactome
Fructose catabolism
Reactome
Fructose metabolism
Reactome
Metabolism
Name
Explore in Pharos
Explore in Source
Biological oxidations
Ethanol oxidation
Fructose catabolism
Fructose metabolism
Metabolism
Gene Ontology Terms (16)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence or structural Similarity (ISS)
CAFA
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Traceable Author Statement (TAS)
UniProtKB
Protein-Protein Interactions (169)
1 – 10 of 169
IL21
Tbio
Novelty: 0.00383812
p_int: 0.846032248
p_ni: 0.128541769
p_wrong: 0.025425983
Score: 0.692
Data Source: BioPlex,STRINGDB
CYP26A1
Tchem
Family: Enzyme
Novelty: 0.00347611
Score: 0.967
Data Source: STRINGDB
CYP26B1
Tchem
Novelty: 0.01159641
Score: 0.958
Data Source: STRINGDB
CYP26C1
Tbio
Novelty: 0.08119341
Score: 0.953
Data Source: STRINGDB
RDH11
Tbio
Family: Enzyme
Novelty: 0.005283
Score: 0.95
Data Source: STRINGDB
DHRS9
Tbio
Family: Enzyme
Novelty: 0.00329747
Score: 0.947
Data Source: STRINGDB
RDH12
Tbio
Family: Enzyme
Novelty: 0.02331361
Score: 0.945
Data Source: STRINGDB
RDH5
Tbio
Family: Enzyme
Novelty: 0.01533722
Score: 0.943
Data Source: STRINGDB
DHRS3
Tbio
Family: Enzyme
Novelty: 0.05219166
Score: 0.938
Data Source: STRINGDB
BCO1
Tbio
Family: Enzyme
Novelty: 0.00308805
Score: 0.934
Data Source: STRINGDB
Publication Statistics
PubMed Score  697.12

PubMed score by year
PubTator Score  602.36

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQA
1-70
FQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKI
70-140
QGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIK
140-210
EAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLA
210-280
DADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQ
280-350
YDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKR
350-420
ANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVK
420-490
TVTVKISQKNS
490-501
MSSSGTPDLPVLLTDLKIQYTKIFINNEWHDSVSGKKFPVFNPATEEELCQVEEGDKEDVDKAVKAARQAFQIGSPWRTMDASERGRLLYKLADLIERDRLLLATMESMNGGKLYSNAYLNDLAGCIKTLRYCAGWADKIQGRTIPIDGNFFTYTRHEPIGVCGQIIPWNFPLVMLIWKIGPALSCGNTVVVKPAEQTPLTALHVASLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDIDKVAFTGSTEVGKLIKEAAGKSNLKRVTLELGGKSPCIVLADADLDNAVEFAHHGVFYHQGQCCIAASRIFVEESIYDEFVRRSVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGGGPWGNKGYFVQPTVFSNVTDEMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGVFTKDIDKAITISSALQAGTVWVNCYGVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTVKISQKNS