You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
LDHA
L-lactate dehydrogenase A chain

Protein Summary
Description
The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene. [provided by RefSeq, Sep 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000227157
  • ENSP00000227157
  • ENSG00000134333
  • ENST00000379412
  • ENSP00000368722
  • ENST00000396222
  • ENSP00000379524
  • ENST00000422447
  • ENSP00000395337
  • ENST00000430553
  • ENSP00000406172
  • ENST00000540430
  • ENSP00000445175
  • ENST00000542179
  • ENSP00000445331

Symbol
  • LDHM
  • GSD11
  • PIG19
  • HEL-S-133P
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
interacting protein
1
protein complex
1
virus perturbation
0.98
kinase perturbation
0.97


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1099.59   (req: < 5)
Gene RIFs: 123   (req: <= 3)
Antibodies: 810   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1099.59   (req: >= 5)
Gene RIFs: 123   (req: > 3)
Antibodies: 810   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 18
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 80
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (31)
1 – 5 of 31
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (31)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Pyruvate metabolism
Reactome
Pyruvate metabolism and Citric Acid (TCA) cycle
Reactome
The citric acid (TCA) cycle and respiratory electron transport
Name
Explore in Pharos
Explore in Source
Metabolism
Pyruvate metabolism
Pyruvate metabolism and Citric Acid (TCA) cycle
The citric acid (TCA) cycle and respiratory electron transport
Protein-Protein Interactions (291)
1 – 10 of 291
LDHC
Tbio
Family: Enzyme
Novelty: 0.00250253
p_int: 0.999999996
p_ni: 4e-9
Score: 0.914
Data Source: BioPlex,STRINGDB
LDHB
Tchem
Family: Enzyme
Novelty: 0.00295207
p_int: 0.999166363
p_ni: 0.000833637
Score: 0.994
Data Source: BioPlex,Reactome,STRINGDB
HIF1A
Tchem
Family: TF
Novelty: 0.00031917
Score: 0.979
Data Source: STRINGDB
PKM
Tchem
Family: Kinase
Novelty: 0.00066016
Score: 0.977
Data Source: STRINGDB
ME2
Tbio
Novelty: 0.01912856
Score: 0.971
Data Source: STRINGDB
LDHD
Tbio
Family: Enzyme
Novelty: 0.03196952
Score: 0.969
Data Source: STRINGDB
PC
Tbio
Family: Enzyme
Novelty: 0.00322567
Score: 0.965
Data Source: STRINGDB
ARNT
Tbio
Family: TF
Novelty: 0.00291828
Score: 0.959
Data Source: STRINGDB
GPI
Tbio
Family: Enzyme
Novelty: 0.00073017
Score: 0.945
Data Source: STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.945
Data Source: STRINGDB
Publication Statistics
PubMed Score  1099.59

PubMed score by year
PubTator Score  377.05

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSL
1-70
FLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPV
70-140
DILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVS
140-210
LKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGL
210-280
YGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF
280-332
MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKEQWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGISDLVKVTLTSEEEARLKKSADTLWGIQKELQF