You are using an outdated browser. Please upgrade your browser to improve your experience.

Tclin
ADH1C
Alcohol dehydrogenase 1C

Protein Summary
Description
This gene encodes class I alcohol dehydrogenase, gamma subunit, which is a member of the alcohol dehydrogenase family. Members of this enzyme family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Class I alcohol dehydrogenase, consisting of several homo- and heterodimers of alpha, beta, and gamma subunits, exhibits high activity for ethanol oxidation and plays a major role in ethanol catabolism. Three genes encoding alpha, beta and gamma subunits are tandemly organized in a genomic segment as a gene cluster. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000515683
  • ENSP00000426083
  • ENSG00000248144

Symbol
  • ADH3
  • ADH3
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
1
cell type or tissue
0.89
protein domain
0.85
drug
0.81
pathway
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 158.56   (req: < 5)
Gene RIFs: 104   (req: <= 3)
Antibodies: 125   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 158.56   (req: >= 5)
Gene RIFs: 104   (req: > 3)
Antibodies: 125   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 1
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 1
Approved Drugs (1)
1 – 1 of 1
fomepizole
chemical structure image
Active Ligands (1)
1 – 1 of 1
CHEMBL48122
chemical structure image
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (30)
Biological oxidations (R-HSA-211859)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 8
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Biological oxidations
Reactome
Ethanol oxidation
Reactome
Metabolism
Reactome
Phase I - Functionalization of compounds
Reactome
RA biosynthesis pathway
Name
Explore in Pharos
Explore in Source
Biological oxidations
Ethanol oxidation
Metabolism
Phase I - Functionalization of compounds
RA biosynthesis pathway
Protein-Protein Interactions (84)
1 – 10 of 84
ADH1B
Tclin
Family: Enzyme
Novelty: 0.00267745
p_int: 1
Score: 0.973
Data Source: BioPlex,Reactome,STRINGDB
XYLT1
Tbio
Family: Enzyme
Novelty: 0.00684001
p_int: 0.993270764
p_wrong: 0.006729236
Score: 0.699
Data Source: BioPlex,STRINGDB
CYP2E1
Tchem
Novelty: 0.00037342
Score: 0.974
Data Source: STRINGDB
ALDH2
Tclin
Family: Enzyme
Novelty: 0.00094367
Score: 0.946
Data Source: STRINGDB
CYP26A1
Tchem
Family: Enzyme
Novelty: 0.00347611
Score: 0.924
Data Source: STRINGDB
LRAT
Tbio
Family: Enzyme
Novelty: 0.02898976
Score: 0.923
Data Source: STRINGDB
AOX1
Tbio
Family: Enzyme
Novelty: 0.00323057
Score: 0.918
Data Source: STRINGDB
ADH1A
Tclin
Family: Enzyme
Novelty: 0.00278351
Score: 0.916
Data Source: Reactome,STRINGDB
RETSAT
Tdark
Family: Enzyme
Novelty: 0.14624727
Score: 0.913
Data Source: STRINGDB
BCO1
Tbio
Family: Enzyme
Novelty: 0.00308805
Score: 0.911
Data Source: STRINGDB
Publication Statistics
PubMed Score  158.56

PubMed score by year
PubTator Score  192.39

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVTPLPVILGHEA
1-70
AGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHH
70-140
FVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVVM
140-210
GCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASL
210-280
LCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNI
280-350
LPFEKINEGFDLLRSGKSIRTVLTF
350-375
MSTAGKVIKCKAAVLWELKKPFSIEEVEVAPPKAHEVRIKMVAAGICRSDEHVVSGNLVTPLPVILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRICKNPESNYCLKNDLGNPRGTLQDGTRRFTCSGKPIHHFVGVSTFSQYTVVDENAVAKIDAASPLEKVCLIGCGFSTGYGSAVKVAKVTPGSTCAVFGLGGVGLSVVMGCKAAGAARIIAVDINKDKFAKAKELGATECINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQNLSINPMLLLTGRTWKGAIFGGFKSKESVPKLVADFMAKKFSLDALITNILPFEKINEGFDLLRSGKSIRTVLTF