You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
NSD2
Histone-lysine N-methyltransferase NSD2

Protein Summary
Description
Histone methyltransferase with histone H3 'Lys-27' (H3K27me) methyltransferase activity. Isoform 2 may act as a transcription regulator that binds DNA and suppresses IL5 transcription through HDAC recruitment. This gene encodes a protein that contains four domains present in other developmental proteins: a PWWP domain, an HMG box, a SET domain, and a PHD-type zinc finger. It is expressed ubiquitously in early development. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene maps to the 165 kb WHS critical region and has also been involved in the chromosomal translocation t(4;14)(p16.3;q32.3) in multiple myelomas. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. Some transcript variants are nonsense-mediated mRNA (NMD) decay candidates, hence not represented as reference sequences. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000312087
  • ENSP00000308780
  • ENSG00000109685
  • ENST00000353275
  • ENSP00000329167
  • ENST00000382888
  • ENSP00000372344
  • ENST00000382891
  • ENSP00000372347
  • ENST00000382892
  • ENSP00000372348
  • ENST00000382895
  • ENSP00000372351
  • ENST00000398261
  • ENSP00000381311
  • ENST00000420906
  • ENSP00000399251
  • ENST00000436793
  • ENSP00000416725
  • ENST00000503128
  • ENSP00000425761
  • ENST00000508803
  • ENSP00000423972
  • ENST00000512700
  • ENSP00000427516
  • ENST00000514045
  • ENSP00000421681

Symbol
  • KIAA1090
  • MMSET
  • TRX5
  • WHSC1
  • WHS
  • TRX5
  • KMT3F
  • KMT3G
  • MMSET
  • WHSC1
  • REIIBP
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0
biological term
0
cell line
0
cell type or tissue
0
cellular component
0


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 313.62   (req: < 5)
Gene RIFs: 60   (req: <= 3)
Antibodies: 176   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 313.62   (req: >= 5)
Gene RIFs: 60   (req: > 3)
Antibodies: 176   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 17
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 37
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Active Ligands (37)
1 – 10 of 37
CHEMBL66953
chemical structure image
CHEMBL607979
chemical structure image
CHEMBL417727
chemical structure image
CHEMBL1381627
chemical structure image
CHEMBL1969046
chemical structure image
CHEMBL1343539
chemical structure image
CHEMBL1399113
chemical structure image
CHEMBL1571034
chemical structure image
CHEMBL1163377
chemical structure image
CHEMBL1424694
chemical structure image
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (18)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 15
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Cell Cycle Checkpoints
Reactome
Chromatin modifying enzymes
Reactome
Chromatin organization
Reactome
DNA Double Strand Break Response
Name
Explore in Pharos
Explore in Source
Cell Cycle
Cell Cycle Checkpoints
Chromatin modifying enzymes
Chromatin organization
DNA Double Strand Break Response
Gene Ontology Terms (21)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
Reactome
Traceable Author Statement (TAS)
Reactome
Inferred from Electronic Annotation (IEA)
Ensembl
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (214)
1 – 10 of 214
WDR46
Tdark
Novelty: 0.36421448
p_int: 0.993998655
p_ni: 0.006001345
Score: 0.167
Data Source: BioPlex,STRINGDB
RPL11
Tbio
Novelty: 0.00566877
p_int: 0.984680341
p_ni: 0.015319659
Score: 0.155
Data Source: BioPlex,STRINGDB
DGCR8
Tbio
Novelty: 0.00319395
p_int: 0.978419524
p_ni: 0.021580476
Score: 0.175
Data Source: BioPlex,STRINGDB
RPL30
Tbio
Novelty: 0.0256669
p_int: 0.976604657
p_ni: 0.023395343
Score: 0.254
Data Source: BioPlex,STRINGDB
HIST1H1E
Tbio
Novelty: 0.01235386
p_int: 0.965841782
p_ni: 0.034158218
Score: 0.173
Data Source: BioPlex,STRINGDB
PRDM5
Tbio
Family: TF; Epigenetic
Novelty: 0.01560016
p_int: 0.965634409
p_ni: 0.034365591
Score: 0.361
Data Source: BioPlex,STRINGDB
RPL7A
Tbio
Novelty: 0.01810261
p_int: 0.960354693
p_ni: 0.039645307
Data Source: BioPlex
ZNF2
Tbio
Family: TF
Novelty: 0.01993056
p_int: 0.959963471
p_ni: 0.040036529
Score: 0.221
Data Source: BioPlex,STRINGDB
CNBP
Tbio
Novelty: 0.0006668
p_int: 0.948583969
p_ni: 0.051416031
Score: 0.25
Data Source: BioPlex,STRINGDB
ZNF692
Tbio
Family: TF
Novelty: 0.06511123
p_int: 0.942219879
p_ni: 0.057780121
Score: 0.222
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  313.62

PubMed score by year
PubTator Score  95.18

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDA
1-70
LPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFE
70-140
SSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLEQGLVEAALVSKISSPSDKKIPAKKESCPNT
140-210
GRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKS
210-280
LVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVG
280-350
DQLHLNPQVAKEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGK
350-420
STPQKTAEADPRRGVGSPPGRKKTTVSMPRSRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQ
420-490
WSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAEAEDTPRKRLRTDKHSLRKRD
490-560
TITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSD
560-630
SPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRR
630-700
PEGRFTCSECASGIHSCFVCKESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHAS
700-770
NPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVSWCFVCSKG
770-840
GSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQK
840-910
MKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFREIKLQREARE
910-980
TQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPAGE
980-1050
FCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYML
1050-1120
TIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTV
1120-1190
CRCGASNCSGFLGDRPKTSTTLSSEEKGKKTKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCT
1190-1260
KAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFSCTPDGRSYCCEHDLGA
1260-1330
ASVRSTKTEKPPPEPGKPKGKRRRRRGWRRVTEGK
1330-1365
MEFSIKQSPLSVQSVVKCIKMKQAPEILGSANGKTPSCEVNRECSVFLSKAQLSSSLQEGVMQKFNGHDALPFIPADKLKDLTSRVFNGEPGAHDAKLRFESQEMKGIGTPPNTTPIKNGSPEIKLKITKTYMNGKPLFESSICGDSAADVSQSEENGQKPENKARRNRKRSIKYDSLLEQGLVEAALVSKISSPSDKKIPAKKESCPNTGRDKDHLLKYNVGDLVWSKVSGYPWWPCMVSADPLLHSYTKLKGQKKSARQYHVQFFGDAPERAWIFEKSLVAFEGEGQFEKLCQESAKQAPTKAEKIKLLKPISGKLRAQWEMGIVQAEEAASMSVEERKAKFTFLYVGDQLHLNPQVAKEAGIAAESLGEMAESSGVSEEAAENPKSVREECIPMKRRRRAKLCSSAETLESHPDIGKSTPQKTAEADPRRGVGSPPGRKKTTVSMPRSRKGDAASQFLVFCQKHRDEVVAEHPDASGEEIEELLRSQWSLLSEKQRARYNTKFALVAPVQAEEDSGNVNGKKRNHTKRIQDPTEDAEAEDTPRKRLRTDKHSLRKRDTITDKTARTSSYKAMEAASSLKSQAATKNLSDACKPLKKRNRASTAASSALGFSKSSSPSASLTENEVSDSPGDEPSESPYESADETQTEVSVSSKKSERGVTAKKEYVCQLCEKPGSLLLCEGPCCGAFHLACLGLSRRPEGRFTCSECASGIHSCFVCKESKTDVKRCVVTQCGKFYHEACVKKYPLTVFESRGFRCPLHSCVSCHASNPSNPRPSKGKMMRCVRCPVAYHSGDACLAAGCSVIASNSIICTAHFTARKGKRHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPDCLNIEMPDGSWFCNDCRAGKKLHFQDIIWVKLGNYRWWPAEVCHPKNVPPNIQKMKHEIGEFPVFFFGSKDYYWTHQARVFPYMEGDRGSRYQGVRGIGRVFKNALQEAEARFREIKLQREARETQESERKPPPYKHIKVNKPYGKVQIYTADISEIPKCNCKPTDENPCGFDSECLNRMLMFECHPQVCPAGEFCQNQCFTKRQYPETKIIKTDGKGWGLVAKRDIRKGEFVNEYVGELIDEEECMARIKHAHENDITHFYMLTIDKDRIIDAGPKGNYSRFMNHSCQPNCETLKWTVNGDTRVGLFAVCDIPAGTELTFNYNLDCLGNEKTVCRCGASNCSGFLGDRPKTSTTLSSEEKGKKTKKKTRRRRAKGEGKRQSEDECFRCGDGGQLVLCDRKFCTKAYHLSCLGLGKRPFGKWECPWHHCDVCGKPSTSFCHLCPNSFCKEHQDGTAFSCTPDGRSYCCEHDLGAASVRSTKTEKPPPEPGKPKGKRRRRRGWRRVTEGK