You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
WNT11
Protein Wnt-11

Protein Summary
Description
Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It encodes a protein which shows 97%, 85%, and 63% amino acid identity with mouse, chicken, and Xenopus Wnt11 protein, respectively. This gene may play roles in the development of skeleton, kidney and lung, and is considered to be a plausible candidate gene for High Bone Mass Syndrome. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000322563
  • ENSP00000325526
  • ENSG00000085741

Symbol
  • HWNT11
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
1
molecular function
0.79
transcription factor binding site profile
0.74
PubMedID
0.69
gene perturbation
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 147.14   (req: < 5)
Gene RIFs: 33   (req: <= 3)
Antibodies: 129   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 147.14   (req: >= 5)
Gene RIFs: 33   (req: > 3)
Antibodies: 129   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 54
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (119)
Beta-catenin independent WNT signaling (R-HSA-3858494)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Beta-catenin independent WNT signaling
Reactome
Ca2+ pathway
Reactome
Class B/2 (Secretin family receptors)
Reactome
GPCR ligand binding
Reactome
PCP/CE pathway
Name
Explore in Pharos
Explore in Source
Beta-catenin independent WNT signaling
Ca2+ pathway
Class B/2 (Secretin family receptors)
GPCR ligand binding
PCP/CE pathway
Protein-Protein Interactions (198)
1 – 10 of 198
KLRG2
Tdark
Novelty: 0.77419355
p_int: 0.999981231
p_ni: 0.000002386
p_wrong: 0.000016384
Score: 0.173
Data Source: BioPlex,STRINGDB
PLA2G10
Tchem
Family: Enzyme
Novelty: 0.00367717
p_int: 0.999913042
p_ni: 0.000083127
p_wrong: 0.000003832
Score: 0.177
Data Source: BioPlex,STRINGDB
TMED7
Tdark
Novelty: 0.57942602
p_int: 0.999621162
p_ni: 0.000246087
p_wrong: 0.000132751
Data Source: BioPlex
RETNLB
Tbio
Novelty: 0.00979708
p_int: 0.798342296
p_ni: 0.000178091
p_wrong: 0.201479613
Data Source: BioPlex
WNT16
Tbio
Novelty: 0.01638935
p_int: 0.756860243
p_ni: 0.000460793
p_wrong: 0.242678964
Score: 0.937
Data Source: BioPlex,STRINGDB
FZD7
Tbio
Family: GPCR
Novelty: 0.01307342
Score: 0.986
Data Source: Reactome,STRINGDB
DVL2
Tbio
Novelty: 0.01142063
Score: 0.978
Data Source: Reactome,STRINGDB
FZD1
Tbio
Family: GPCR
Novelty: 0.00772255
Score: 0.978
Data Source: Reactome,STRINGDB
DVL1
Tchem
Novelty: 0.00460899
Score: 0.978
Data Source: STRINGDB
FZD2
Tbio
Family: GPCR
Novelty: 0.01294873
Score: 0.977
Data Source: STRINGDB
Publication Statistics
PubMed Score  147.14

PubMed score by year
PubTator Score  69.16

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVV
1-70
HAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHAIARACTSGDLPGCSC
70-140
GPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCK
140-210
CHGVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSP
210-280
DFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVER
280-350
YVCK
350-354
MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK