You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PPP1R17
Protein phosphatase 1 regulatory subunit 17

Protein Summary
Description
Inhibits phosphatase activities of protein phosphatase 1 (PP1) and protein phosphatase 2A (PP2A) complexes. The protein encoded by this gene is found primarily in cerebellar Purkinje cells, where it functions as a protein phosphatase inhibitor. The encoded protein is a substrate for cGMP-dependent protein kinase. An allele of this gene was discovered that increases susceptibility to hypercholesterolemia. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000342032
  • ENSP00000340125
  • ENSG00000106341
  • ENST00000409146
  • ENSP00000386459

Symbol
  • C7orf16
  • GSBS
  • GSBS
  • C7orf16
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
0.84
kinase perturbation
0.54
cell line
0.5
virus perturbation
0.5
chemical
0.42


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 203.58   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 121   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 203.58   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 121   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (35)
1 – 10 of 35
PRKG1
Tchem
Family: Kinase
Novelty: 0.00177043
Score: 0.946
Data Source: STRINGDB
PRKG2
Tchem
Family: Kinase
Novelty: 0.01736783
Score: 0.898
Data Source: STRINGDB
PPP2CB
Tbio
Family: Enzyme
Novelty: 0.06629168
Score: 0.8
Data Source: STRINGDB
PPP2CA
Tchem
Family: Enzyme
Novelty: 0.00655436
Score: 0.8
Data Source: STRINGDB
PPP2R1B
Tbio
Family: Enzyme
Novelty: 0.06111104
Score: 0.8
Data Source: STRINGDB
PPP2R1A
Tbio
Family: Enzyme
Novelty: 0.01848436
Score: 0.8
Data Source: STRINGDB
PPAN
Tbio
Novelty: 0.0010549
Score: 0.704
Data Source: STRINGDB
ISL2
Tbio
Family: TF
Novelty: 0.03469276
Score: 0.587
Data Source: STRINGDB
MANBA
Tchem
Family: Enzyme
Novelty: 0.00878537
Score: 0.543
Data Source: STRINGDB
EPHX2
Tchem
Family: Enzyme
Novelty: 0.00298106
Score: 0.539
Data Source: STRINGDB
Publication Statistics
PubMed Score  203.58

PubMed score by year
PubTator Score  17.84

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MMSTEQMQPLELSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPA
1-70
LHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPK
70-140
AIVEDDEKDGDKIAI
140-155
MMSTEQMQPLELSEDRLDKLDPRCSHLDDLSDQFIKDCDLKKKPRKGKNVQATLNVESDQKKPRRKDTPALHIPPFIPGVFSEHLIKRYDVQERHPKGKMIPVLHNTDLEQKKPRRKDTPALHMSPFAAGVTLLRDERPKAIVEDDEKDGDKIAI