You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
IGSF6
Immunoglobulin superfamily member 6

Protein Summary
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000268389
  • ENSP00000268389
  • ENSG00000140749
  • ENST00000639480
  • ENSP00000491064
  • ENSG00000283934

Symbol
  • DORA
  • DORA
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.76
tissue sample
0.62
gene perturbation
0.59
protein domain
0.58
co-expressed gene
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 78.55   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 172   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 78.55   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 172   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (4)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (80)
1 – 10 of 80
GNPTAB
Tbio
Family: Enzyme
Novelty: 0.00670261
p_int: 0.999632964
p_ni: 0.000367035
p_wrong: 1e-9
Score: 0.187
Data Source: BioPlex,STRINGDB
RANGRF
Tbio
Family: Enzyme
Novelty: 0.04154228
p_int: 0.981363371
p_ni: 0.001728712
p_wrong: 0.016907916
Score: 0.188
Data Source: BioPlex,STRINGDB
AP3S1
Tbio
Novelty: 0.23622047
p_int: 0.929855255
p_ni: 0.070144745
p_wrong: 1e-9
Score: 0.179
Data Source: BioPlex,STRINGDB
CWC27
Tbio
Family: Enzyme
Novelty: 0.25945946
p_int: 0.925275091
p_ni: 0.074724909
Score: 0.309
Data Source: BioPlex,STRINGDB
CETN3
Tbio
Novelty: 0.0104296
p_int: 0.909804014
p_ni: 0.090195971
p_wrong: 1.5e-8
Score: 0.187
Data Source: BioPlex,STRINGDB
CANX
Tbio
Novelty: 0.00135361
p_int: 0.786776681
p_ni: 0.213223319
Data Source: BioPlex
METTL9
Tdark
Family: Enzyme
Novelty: 0.16438356
Score: 0.931
Data Source: STRINGDB
TYROBP
Tbio
Family: Enzyme
Novelty: 0.00522854
Score: 0.813
Data Source: STRINGDB
CSF1R
Tclin
Family: Kinase
Novelty: 0.00058475
Score: 0.771
Data Source: STRINGDB
ITGAX
Tbio
Novelty: 0.00064197
Score: 0.746
Data Source: STRINGDB
Publication Statistics
PubMed Score  78.55

PubMed score by year
PubTator Score  19.03

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGTASRSNIARHLQTNLILFCVGAVGACTLSVTQPWYLEVDYTHEAVTIKCTFSATGCPSEQPTCLWFRY
1-70
GAHQPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEARAKQTGGGTTLV
70-140
VREIKLLSKELRSFLTALVSLLSVYVTGVCVAFILLSKSKSNPLRNKEIKEDSQKKKSARRIFQEIAQEL
140-210
YHKRHVETNQQSEKDNNTYENRRVLSNYERP
210-241
MGTASRSNIARHLQTNLILFCVGAVGACTLSVTQPWYLEVDYTHEAVTIKCTFSATGCPSEQPTCLWFRYGAHQPENLCLDGCKSEADKFTVREALKENQVSLTVNRVTSNDSAIYICGIAFPSVPEARAKQTGGGTTLVVREIKLLSKELRSFLTALVSLLSVYVTGVCVAFILLSKSKSNPLRNKEIKEDSQKKKSARRIFQEIAQELYHKRHVETNQQSEKDNNTYENRRVLSNYERP