You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BMP15
Bone morphogenetic protein 15

Protein Summary
Description
May be involved in follicular development. Oocyte-specific growth/differentiation factor that stimulates folliculogenesis and granulosa cell (GC) growth. This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate subunits of a disulfide-linked homodimer, or alternatively, a heterodimer, with the related protein, growth differentiation factor 9 (GDF9). This protein plays a role in oocyte maturation and follicular development, through activation of granulosa cells. Defects in this gene are the cause of ovarian dysgenesis and are associated with premature ovarian failure. [provided by RefSeq, Aug 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000252677
  • ENSP00000252677
  • ENSG00000130385

Symbol
  • GDF9B
  • ODG2
  • POF4
  • GDF9B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.85
biological process
0.68
tissue sample
0.68
tissue
0.66
cell line
0.6


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 236.71   (req: < 5)
Gene RIFs: 59   (req: <= 3)
Antibodies: 305   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 236.71   (req: >= 5)
Gene RIFs: 59   (req: > 3)
Antibodies: 305   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 15
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (15)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Post-translational protein modification
Reactome
Post-translational protein phosphorylation
Reactome
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Post-translational protein modification
Post-translational protein phosphorylation
Regulation of Insulin-like Growth Factor (IGF) transport and uptake by Insulin-like Growth Factor Binding Proteins (IGFBPs)
Protein-Protein Interactions (183)
1 – 10 of 183
AMD1
Tchem
Family: Enzyme
Novelty: 0.00107659
p_int: 0.999389016
p_ni: 0.000610984
Score: 0.204
Data Source: BioPlex,STRINGDB
DCAF6
Tbio
Novelty: 0.01642135
p_int: 0.985867847
p_ni: 0.014132153
Score: 0.294
Data Source: BioPlex,STRINGDB
HECTD1
Tbio
Family: Enzyme
Novelty: 0.36734694
p_int: 0.975807196
p_ni: 0.024192804
Score: 0.223
Data Source: BioPlex,STRINGDB
FAM20C
Tbio
Family: Enzyme
Novelty: 0.004596
Score: 0.941
Data Source: STRINGDB
FSTL3
Tbio
Novelty: 0.01389903
Score: 0.922
Data Source: STRINGDB
SPP1
Tbio
Novelty: 0.00020502
Score: 0.919
Data Source: STRINGDB
BMP4
Tchem
Novelty: 0.00057391
Score: 0.918
Data Source: STRINGDB
IGFBP4
Tchem
Novelty: 0.00324108
Score: 0.917
Data Source: STRINGDB
IGFBP7
Tbio
Novelty: 0.00155903
Score: 0.914
Data Source: STRINGDB
VCAN
Tbio
Novelty: 0.00132314
Score: 0.913
Data Source: STRINGDB
Publication Statistics
PubMed Score  236.71

PubMed score by year
PubTator Score  117.63

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVLLSILRILFLCELVLFMEHRAQMAEGGQSSIALLAEAPTLPLIEELLEESPGEQPRKPRLLGHSLRYM
1-70
LELYRRSADSHGHPRENRTIGATMVRLVKPLTNVARPHRGTWHIQILGFPLRPNRGLYQLVRATVVYRHH
70-140
LQLTRFNLSCHVEPWVQKNPTNHFPSSEGDSSKPSLMSNAWKEMDITQLVQQRFWNNKGHRILRLRFMCQ
140-210
QQKDSGGLELWHGTSSLDIAFLLLYFNDTHKSIRKAKFLPRGMEEFMERESLLRRTRQADGISAEVTASS
210-280
SKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQ
280-350
SVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR
350-392
MVLLSILRILFLCELVLFMEHRAQMAEGGQSSIALLAEAPTLPLIEELLEESPGEQPRKPRLLGHSLRYMLELYRRSADSHGHPRENRTIGATMVRLVKPLTNVARPHRGTWHIQILGFPLRPNRGLYQLVRATVVYRHHLQLTRFNLSCHVEPWVQKNPTNHFPSSEGDSSKPSLMSNAWKEMDITQLVQQRFWNNKGHRILRLRFMCQQQKDSGGLELWHGTSSLDIAFLLLYFNDTHKSIRKAKFLPRGMEEFMERESLLRRTRQADGISAEVTASSSKHSGPENNQCSLHPFQISFRQLGWDHWIIAPPFYTPNYCKGTCLRVLRDGLNSPNHAIIQNLINQLVDQSVPRPSCVPYKYVPISVLMIEANGSILYKEYEGMIAESCTCR