You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NCR2
Natural cytotoxicity triggering receptor 2

Protein Summary
Description
Cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000373083
  • ENSP00000362175
  • ENSG00000096264
  • ENST00000373086
  • ENSP00000362178
  • ENST00000373089
  • ENSP00000362181

Symbol
  • LY95
  • LY95
  • CD336
  • NKP44
  • NK-p44
  • dJ149M18.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.85
cell line
0.65
biological term
0.58
protein domain
0.58
small molecule perturbation
0.54


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 103.92   (req: < 5)
Gene RIFs: 37   (req: <= 3)
Antibodies: 337   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 103.92   (req: >= 5)
Gene RIFs: 37   (req: > 3)
Antibodies: 337   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (6)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
DAP12 interactions
Reactome
Immune System
Reactome
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Reactome
Innate Immune System
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
DAP12 interactions
Immune System
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Innate Immune System
Gene Ontology Terms (7)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (161)
1 – 10 of 161
TYROBP
Tbio
Family: Enzyme
Novelty: 0.00522854
Score: 0.987
Data Source: Reactome,STRINGDB
NCR3
Tbio
Novelty: 0.00225217
Score: 0.92
Data Source: STRINGDB
NCR1
Tbio
Novelty: 0.00380308
Score: 0.92
Data Source: STRINGDB
KLRK1
Tbio
Novelty: 0.00109238
Score: 0.885
Data Source: STRINGDB
IL15
Tbio
Novelty: 0.00081119
Score: 0.811
Data Source: STRINGDB
IL2
Tchem
Novelty: 0.00004362
Score: 0.81
Data Source: STRINGDB
KLRD1
Tbio
Novelty: 0.00257574
Score: 0.801
Data Source: STRINGDB
KLRC1
Tbio
Novelty: 0.00383875
Score: 0.801
Data Source: STRINGDB
KLRC2
Tbio
Novelty: 0.01176421
Score: 0.791
Data Source: STRINGDB
CD226
Tbio
Novelty: 0.00453644
Score: 0.789
Data Source: STRINGDB
Publication Statistics
PubMed Score  103.92

PubMed score by year
PubTator Score  101.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSS
1-70
KPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSW
70-140
TPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAPIALVPVFCGLLVAKSLVLSA
140-210
LLVWWGDIWWKTMMELRSLDTQKATCHLQQVTDLPWTSVSSPVEREILYHTVARTKISDDDDEHTL
210-276
MAWRALHPLLLLLLLFPGSQAQSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAPIALVPVFCGLLVAKSLVLSALLVWWGDIWWKTMMELRSLDTQKATCHLQQVTDLPWTSVSSPVEREILYHTVARTKISDDDDEHTL