You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SNAI1
Zinc finger protein SNAI1

Protein Summary
Description
Involved in induction of the epithelial to mesenchymal transition (EMT), formation and maintenance of embryonic mesoderm, growth arrest, survival and cell migration. Binds to 3 E-boxes of the E-cadherin/CDH1 gene promoter and to the promoters of CLDN7 and KRT8 and, in association with histone demethylase KDM1A which it recruits to the promoters, causes a decrease in dimethylated H3K4 levels and represses transcription. During EMT, involved with LOXL2 in negatively regulating pericentromeric heterochromatin transcription (By similarity). SNAI1 recruits LOXL2 to pericentromeric regions to oxidize histone H3 and repress transcription which leads to release of heterochromatin component CBX5/HP1A, enabling chromatin reorganization and acquisition of mesenchymal traits (By similarity). Associates with EGR1 and SP1 to mediate tetradecanoyl phorbol acetate (TPA)-induced up-regulation of CDKN2B, possibly by binding to the CDKN2B promoter region 5'-TCACA-3. In addition, may also activate the CDK ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000244050
  • ENSP00000244050
  • ENSG00000124216

Symbol
  • SNAH
  • SNA
  • SNAH
  • SNAIL
  • SLUGH2
  • SNAIL1
  • dJ710H13.1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
biological process
0.97
transcription factor binding site profile
0.95
kinase
0.89
virus perturbation
0.88
biological term
0.87


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2035.57   (req: < 5)
Gene RIFs: 415   (req: <= 3)
Antibodies: 764   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2035.57   (req: >= 5)
Gene RIFs: 415   (req: > 3)
Antibodies: 764   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 29
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (138)
Intracellular signaling by second messengers (R-HSA-9006925)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Intracellular signaling by second messengers
Reactome
PIP3 activates AKT signaling
Reactome
PTEN Regulation
Reactome
Regulation of PTEN gene transcription
Reactome
Signal Transduction
Name
Explore in Pharos
Explore in Source
Intracellular signaling by second messengers
PIP3 activates AKT signaling
PTEN Regulation
Regulation of PTEN gene transcription
Signal Transduction
Gene Ontology Terms (34)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Inferred from Electronic Annotation (IEA)
Ensembl
Protein-Protein Interactions (363)
1 – 10 of 363
EGR2
Tbio
Family: TF
Novelty: 0.00267713
p_int: 0.999998835
p_wrong: 0.000001165
Score: 0.646
Data Source: BioPlex,STRINGDB
GSE1
Tdark
Novelty: 0.07542652
p_int: 0.999986893
p_ni: 0.000013107
Score: 0.816
Data Source: BioPlex,STRINGDB
HMG20A
Tbio
Family: TF
Novelty: 0.18049861
p_int: 0.999951651
p_ni: 0.000048346
p_wrong: 4e-9
Score: 0.749
Data Source: BioPlex,STRINGDB
SIRT2
Tchem
Family: Epigenetic
Novelty: 0.00117896
p_int: 0.999918561
p_ni: 0.000081439
Score: 0.305
Data Source: BioPlex,STRINGDB
RCOR3
Tdark
Family: TF
Novelty: 0.38344492
p_int: 0.996467714
p_ni: 0.003532286
Score: 0.781
Data Source: BioPlex,STRINGDB
DPP9
Tchem
Family: Enzyme
Novelty: 0.01345112
p_int: 0.989618665
p_ni: 0.010381329
p_wrong: 6e-9
Score: 0.183
Data Source: BioPlex,STRINGDB
RCOR1
Tbio
Family: TF
Novelty: 0.00972564
p_int: 0.937050558
p_ni: 0.062949442
Score: 0.997
Data Source: BioPlex,STRINGDB
HMG20B
Tbio
Family: TF
Novelty: 0.08820104
p_int: 0.906496819
p_ni: 0.092839021
p_wrong: 0.00066416
Score: 0.88
Data Source: BioPlex,STRINGDB
FBXL8
Tdark
Novelty: 10
p_int: 0.756315906
p_ni: 8.7e-8
p_wrong: 0.243684008
Score: 0.622
Data Source: BioPlex,STRINGDB
CDH1
Tbio
Novelty: 0.0001303
Score: 0.997
Data Source: STRINGDB
Publication Statistics
PubMed Score  2035.57

PubMed score by year
PubTator Score  2162.58

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQ
1-70
PIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLA
70-140
QLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSC
140-210
PHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR
210-264
MPRSFLVRKPSDPNRKPNYSELQDSNPEFTFQQPYDQAHLLAAIPPPEILNPTASLPMLIWDSVLAPQAQPIAWASLRLQESPRVAELTSLSDEDSGKGSQPPSPPSPAPSSFSSTSVSSLEAEAYAAFPGLGQVPKQLAQLSEAKDLQARKAFNCKYCNKEYLSLGALKMHIRSHTLPCVCGTCGKAFSRPWLLQGHVRTHTGEKPFSCPHCSRAFADRSNLRAHLQTHSDVKKYQCQACARTFSRMSLLHKHQESGCSGCPR