You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TSPAN13
Tetraspanin-13

Protein Summary
Description
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000262067
  • ENSP00000262067
  • ENSG00000106537

Symbol
  • NET6
  • TM4SF13
  • NET6
  • NET-6
  • TM4SF13
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
0.99
disease perturbation
0.83
small molecule perturbation
0.83
gene perturbation
0.77
cell type or tissue
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.32   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 96   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.32   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 96   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 3
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (37)
1 – 10 of 37
ANKMY2
Tdark
Novelty: 1.16129032
Score: 0.775
Data Source: STRINGDB
TSPAN15
Tdark
Novelty: 0.45627376
Score: 0.765
Data Source: STRINGDB
BZW2
Tbio
Novelty: 0.32315978
Score: 0.722
Data Source: STRINGDB
SNX13
Tbio
Novelty: 0.20050923
Score: 0.704
Data Source: STRINGDB
TXNDC12
Tbio
Novelty: 0.02131718
Score: 0.668
Data Source: STRINGDB
USP25
Tbio
Family: Enzyme
Novelty: 0.02945953
Score: 0.627
Data Source: STRINGDB
SPPL2A
Tbio
Family: Enzyme
Novelty: 0.04485742
Score: 0.623
Data Source: STRINGDB
NMT1
Tchem
Family: Enzyme
Novelty: 0.00436862
Score: 0.6
Data Source: STRINGDB
LMAN2L
Tbio
Novelty: 0.01832061
Score: 0.587
Data Source: STRINGDB
AGR3
Tbio
Novelty: 0.0475131
Score: 0.582
Data Source: STRINGDB
Publication Statistics
PubMed Score  5.32

PubMed score by year
PubTator Score  4.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKH
1-70
HQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTC
70-140
LASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL
140-204
MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIALVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARNDIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTEILGVWLTYRYRNQKDPRANPSAFL