You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
STARD3NL
STARD3 N-terminal-like protein

Protein Summary
Description
Tethering protein that creates contact site between the endoplasmic reticulum and late endosomes: localizes to late endosome membranes and contacts the endoplasmic reticulum via interaction with VAPA and VAPB (PubMed:24105263). This gene encodes a late-endosomal protein that contains a conserved MENTAL (MLN64 N-terminal) domain. The encoded protein binds cholesterol molecules and may play a role in endosomal cholesterol transport through interactions with metastatic lymph node protein 64 (MLN64). [provided by RefSeq, Sep 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000009041
  • ENSP00000009041
  • ENSG00000010270
  • ENST00000396013
  • ENSP00000379334

Symbol
  • MENTHO
  • MENTHO
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.81
transcription factor binding site profile
0.75
cell type or tissue
0.73
virus perturbation
0.68
tissue sample
0.66


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.81   (req: < 5)
Gene RIFs: 8   (req: <= 3)
Antibodies: 20   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 2.81   (req: >= 5)
Gene RIFs: 8   (req: > 3)
Antibodies: 20   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 4
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (5)
Metabolism (R-HSA-1430728)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Metabolism of steroid hormones
Reactome
Metabolism of steroids
Reactome
Pregnenolone biosynthesis
Name
Explore in Pharos
Explore in Source
Metabolism
Metabolism of lipids
Metabolism of steroid hormones
Metabolism of steroids
Pregnenolone biosynthesis
Gene Ontology Terms (11)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (38)
1 – 10 of 38
STAR
Tbio
Novelty: 0.00143063
Score: 0.969
Data Source: Reactome,STRINGDB
STARD4
Tbio
Novelty: 0.07217838
Score: 0.915
Data Source: STRINGDB
STARD3
Tbio
Novelty: 0.02326413
Score: 0.904
Data Source: Reactome,STRINGDB
STARD6
Tbio
Novelty: 0.08462623
Score: 0.9
Data Source: STRINGDB
NPC2
Tbio
Novelty: 0.00487879
Score: 0.9
Data Source: STRINGDB
EPDR1
Tbio
Novelty: 0.05021948
Score: 0.806
Data Source: STRINGDB
HECW1
Tdark
Family: Enzyme
Novelty: 0.28099911
Score: 0.717
Data Source: STRINGDB
TOX4
Tbio
Family: TF
Novelty: 0.03661513
Score: 0.714
Data Source: STRINGDB
AMPH
Tbio
Novelty: 0.00195854
Score: 0.671
Data Source: STRINGDB
DCDC1
Tbio
Novelty: 0.44907257
Score: 0.669
Data Source: STRINGDB
Publication Statistics
PubMed Score  2.81

PubMed score by year
PubTator Score  4.08

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MNHLPEDMENALTGSQSSHASLRNIHSINPTQLMARIESYEGREKKGISDVRRTFCLFVTFDLLFVTLLW
1-70
IIELNVNGGIENTLEKEVMQYDYYSSYFDIFLLAVFRFKVLILAYAVCRLRHWWAIALTTAVTSAFLLAK
70-140
VILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYS
140-210
PPESEAGSEEAEEKQDSEKPLLEL
210-234
MNHLPEDMENALTGSQSSHASLRNIHSINPTQLMARIESYEGREKKGISDVRRTFCLFVTFDLLFVTLLWIIELNVNGGIENTLEKEVMQYDYYSSYFDIFLLAVFRFKVLILAYAVCRLRHWWAIALTTAVTSAFLLAKVILSKLFSQGAFGYVLPIISFILAWIETWFLDFKVLPQEAEEENRLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL