You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KLF8
Krueppel-like factor 8

Protein Summary
Description
Transcriptional repressor and activator. Binds to CACCC-boxes promoter elements. Also binds the GT-box of cyclin D1 promoter and mediates cell cycle progression at G(1) phase as a downstream target of focal adhesion kinase (FAK). This gene encodes a protein which is a member of the Sp/KLF family of transcription factors. Members of this family contain a C-terminal DNA-binding domain with three Kruppel-like zinc fingers. The encoded protein is thought to play an important role in the regulation of epithelial to mesenchymal transition, a process which occurs normally during development but also during metastasis. A pseudogene has been identified on chromosome 16. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2009]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000374928
  • ENSP00000364063
  • ENSG00000102349
  • ENST00000468660
  • ENSP00000417303
  • ENST00000640927
  • ENSP00000492126

Symbol
  • BKLF3
  • ZNF741
  • BKLF3
  • ZNF741
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
PubMedID
0.57
cell type or tissue
0.54
microRNA
0.53
biological term
0.47
gene perturbation
0.47


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 59.82   (req: < 5)
Gene RIFs: 37   (req: <= 3)
Antibodies: 211   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 59.82   (req: >= 5)
Gene RIFs: 37   (req: > 3)
Antibodies: 211   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (10)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (49)
1 – 10 of 49
CTBP2
Tchem
Novelty: 0.00203298
Score: 0.82
Data Source: STRINGDB
TCF7L1
Tbio
Family: TF
Novelty: 0.0511399
Score: 0.675
Data Source: STRINGDB
CDH1
Tbio
Novelty: 0.0001303
Score: 0.674
Data Source: STRINGDB
SART1
Tbio
Novelty: 0.01404622
Score: 0.64
Data Source: STRINGDB
PQLC3
Tdark
Score: 0.628
Data Source: STRINGDB
FOXC2
Tbio
Family: TF
Novelty: 0.00583209
Score: 0.571
Data Source: STRINGDB
CTBP1
Tbio
Novelty: 0.00313629
Score: 0.558
Data Source: STRINGDB
KDM5B
Tchem
Family: TF; Epigenetic
Novelty: 0.00508605
Score: 0.546
Data Source: STRINGDB
CD151
Tbio
Novelty: 0.00358939
Score: 0.542
Data Source: STRINGDB
EP300
Tchem
Family: Epigenetic
Novelty: 0.00060382
Score: 0.534
Data Source: STRINGDB
Publication Statistics
PubMed Score  59.82

PubMed score by year
PubTator Score  39.01

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEP
1-70
PEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTVLT
70-140
PGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDG
140-210
KNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAG
210-280
CSKVYTKSSHLKAHRRIHTGEKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLS
280-350
LHRRRHDTM
350-359
MVDMDKLINNLEVQLNSEGGSMQVFKQVTASVRNRDPPEIEYRSNMTSPTLLDANPMENPALFNDIKIEPPEELLASDFSLPQVEPVDLSFHKPKAPLQPASMLQAPIRPPKPQSSPQTLVVSTSTSDMSTSANIPTVLTPGSVLTSSQSTGSQQILHVIHTIPSVSLPNKMGGLKTIPVVVQSLPMVYTTLPADGGPAAITVPLIGGDGKNAGSVKVDPTSMSPLEIPSDSEESTIESGSSALQSLQGLQQEPAAMAQMQGEESLDLKRRRIHQCDFAGCSKVYTKSSHLKAHRRIHTGEKPYKCTWDGCSWKFARSDELTRHFRKHTGIKPFRCTDCNRSFSRSDHLSLHRRRHDTM