You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
BMP10
Bone morphogenetic protein 10

Protein Summary
Description
Required for maintaining the proliferative activity of embryonic cardiomyocytes by preventing premature activation of the negative cell cycle regulator CDKN1C/p57KIP and maintaining the required expression levels of cardiogenic factors such as MEF2C and NKX2-5. Acts as a ligand for ACVRL1/ALK1, BMPR1A/ALK3 and BMPR1B/ALK6, leading to activation of SMAD1, SMAD5 and SMAD8 transcription factors. Inhibits endothelial cell migration and growth. May reduce cell migration and cell matrix adhesion in breast cancer cell lines. This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which binds to the activin receptor-like kinase 1 (ALK1) and plays important roles in cardiovascular development incl ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000295379
  • ENSP00000295379
  • ENSG00000163217
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
co-expressed gene
1
biological process
0.99
protein domain
0.85
gene perturbation
0.68
cell line
0.56


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 29.6   (req: < 5)
Gene RIFs: 14   (req: <= 3)
Antibodies: 360   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 29.6   (req: >= 5)
Gene RIFs: 14   (req: > 3)
Antibodies: 360   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 34
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (169)
Elastic fibre formation (R-HSA-1566948)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 6
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Elastic fibre formation
Reactome
Extracellular matrix organization
Reactome
Molecules associated with elastic fibres
Reactome
Signal Transduction
Reactome
Signaling by BMP
Name
Explore in Pharos
Explore in Source
Elastic fibre formation
Extracellular matrix organization
Molecules associated with elastic fibres
Signal Transduction
Signaling by BMP
Gene Ontology Terms (39)
Items per page:
10
1 – 6 of 6
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
BHF-UCL
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
BHF-UCL
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (58)
1 – 10 of 58
ACVRL1
Tchem
Family: Kinase
Novelty: 0.00374091
Score: 0.984
Data Source: Reactome,STRINGDB
BMPR2
Tchem
Family: Kinase
Novelty: 0.00191079
Score: 0.977
Data Source: STRINGDB
BMPR1A
Tchem
Family: Kinase
Novelty: 0.00472897
Score: 0.964
Data Source: STRINGDB
NKX2-5
Tbio
Family: TF
Novelty: 0.00147966
Score: 0.962
Data Source: STRINGDB
GATA4
Tbio
Family: TF
Novelty: 0.00115226
Score: 0.943
Data Source: STRINGDB
BMP5
Tbio
Novelty: 0.01102598
Score: 0.918
Data Source: STRINGDB
BMP7
Tbio
Novelty: 0.000658
Score: 0.917
Data Source: STRINGDB
BMP4
Tchem
Novelty: 0.00057391
Score: 0.914
Data Source: STRINGDB
BMP2
Tbio
Novelty: 0.00020018
Score: 0.912
Data Source: STRINGDB
ATF2
Tbio
Family: TF
Novelty: 0.00562547
Score: 0.902
Data Source: STRINGDB
Publication Statistics
PubMed Score  29.60

PubMed score by year
PubTator Score  16.67

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGSLVLTLCALFCLAAYLVSGSPIMNLEQSPLEEDMSLFGDVFSEQDGVDFNTLLQSMKDEFLKTLNLSD
1-70
IPTQDSAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLFSQPVSFNGLRKYPLLFNVSIPHHEEV
70-140
IMAELRLYTLVQRDRMIYDGVDRKITIFEVLESKGDNEGERNMLVLVSGEIYGTNSEWETFDVTDAIRRW
140-210
QKSGSSTHQLEVHIESKHDEAEDASSGRLEIDTSAQNKHNPLLIVFSDDQSSDKERKEELNEMISHEQLP
210-280
ELDNLGLDSFSSGPGEEALLQMRSNIIYDSTARIRRNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAY
280-350
ECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSE
350-420
CGCR
420-424
MGSLVLTLCALFCLAAYLVSGSPIMNLEQSPLEEDMSLFGDVFSEQDGVDFNTLLQSMKDEFLKTLNLSDIPTQDSAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLFSQPVSFNGLRKYPLLFNVSIPHHEEVIMAELRLYTLVQRDRMIYDGVDRKITIFEVLESKGDNEGERNMLVLVSGEIYGTNSEWETFDVTDAIRRWQKSGSSTHQLEVHIESKHDEAEDASSGRLEIDTSAQNKHNPLLIVFSDDQSSDKERKEELNEMISHEQLPELDNLGLDSFSSGPGEEALLQMRSNIIYDSTARIRRNAKGNYCKRTPLYIDFKEIGWDSWIIAPPGYEAYECRGVCNYPLAEHLTPTKHAIIQALVHLKNSQKASKACCVPTKLEPISILYLDKGVVTYKFKYEGMAVSECGCR