You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CELF2
CUGBP Elav-like family member 2

Protein Summary
Description
RNA-binding protein implicated in the regulation of several post-transcriptional events. Involved in pre-mRNA alternative splicing, mRNA translation and stability. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of TNNT2 in embryonic, but not adult, skeletal muscle. Activates TNNT2 exon 5 inclusion by antagonizing the repressive effect of PTB. Acts as both an activator and repressor of a pair of coregulated exons: promotes inclusion of the smooth muscle (SM) exon but exclusion of the non-muscle (NM) exon in actinin pre-mRNAs. Promotes inclusion of exonS 21 and exclusion of exon 5 of the NMDA receptor R1 pre-mRNA. Involved in the apoB RNA editing activity. Increases COX2 mRNA stability and inhibits COX2 mRNA translation in epithelial cells after radiation injury (By similarity). Modulates the cellular apoptosis program by regulating COX2-mediated prostagla ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000399850
  • ENSP00000382743
  • ENSG00000048740
  • ENST00000416382
  • ENSP00000406451
  • ENST00000417956
  • ENSP00000404834
  • ENST00000608830
  • ENSP00000476999
  • ENST00000631460
  • ENSP00000488582
  • ENST00000632728
  • ENSP00000487802
  • ENST00000638035
  • ENSP00000490401

Symbol
  • BRUNOL3
  • CUGBP2
  • ETR3
  • NAPOR
  • ETR3
  • ETR-3
  • NAPOR
  • CELF-2
  • CUGBP2
  • BRUNOL3
  • CUG-BP2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
transcription factor perturbation
1
kinase perturbation
0.95
trait
0.93
interacting protein
0.92
disease perturbation
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.36   (req: < 5)
Gene RIFs: 26   (req: <= 3)
Antibodies: 219   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.36   (req: >= 5)
Gene RIFs: 26   (req: > 3)
Antibodies: 219   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (6)
1 – 5 of 6
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (10)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (77)
1 – 10 of 77
HNRNPC
Tbio
Novelty: 0.00195495
Score: 0.907
Data Source: STRINGDB
CEBPD
Tbio
Family: TF
Novelty: 0.00289107
Score: 0.868
Data Source: STRINGDB
RALY
Tbio
Novelty: 0.08299836
Score: 0.789
Data Source: STRINGDB
PTGS2
Tclin
Family: Enzyme
Novelty: 0.00008134
Score: 0.788
Data Source: STRINGDB
MBNL1
Tbio
Novelty: 0.00455774
Score: 0.784
Data Source: STRINGDB
MBNL3
Tbio
Novelty: 0.05387236
Score: 0.76
Data Source: STRINGDB
MBNL2
Tbio
Novelty: 0.04290304
Score: 0.75
Data Source: STRINGDB
APOBEC1
Tbio
Novelty: 0.00924384
Score: 0.727
Data Source: STRINGDB
XRN1
Tbio
Family: Enzyme
Novelty: 0.00630563
Score: 0.721
Data Source: STRINGDB
RBM24
Tbio
Novelty: 0.05713269
Score: 0.7
Data Source: STRINGDB
Publication Statistics
PubMed Score  50.36

PubMed score by year
PubTator Score  41.1

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRCPKSAVTMRNEELLLSNGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQIN
1-70
VLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVS
70-140
KKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFA
140-210
DTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQL
210-280
QNLATLAAAAAAAQTSATSTNANPLSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVG
280-350
LNNINALAGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGP
350-420
EGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIG
420-490
MKRLKVQLKRSKNDSKPY
490-508
MRCPKSAVTMRNEELLLSNGTANKMNGALDHSDQPDPDAIKMFVGQIPRSWSEKELKELFEPYGAVYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSPFGQIEECRILRGPDGLSRGCAFVTFSTRAMAQNAIKAMHQSQTMEGCSSPIVVKFADTQKDKEQRRLQQQLAQQMQQLNTATWGNLTGLGGLTPQYLALLQQATSSSNLGAFSGIQQMAGMNALQLQNLATLAAAAAAAQTSATSTNANPLSTTSSALGALTSPVAASTPNSTAGAAMNSLTSLGTLQGLAGATVGLNNINALAGMAALNGGLGATGLTNGTAGTMDALTQAYSGIQQYAAAALPTLYSQSLLQQQSAAGSQKEGPEGANLFIYHLPQEFGDQDILQMFMPFGNVISAKVFIDKQTNLSKCFGFVSYDNPVSAQAAIQAMNGFQIGMKRLKVQLKRSKNDSKPY