You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
HTR3B
5-hydroxytryptamine receptor 3B

Protein Summary
Description
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It is not functional as a homomeric complex, but a pentaheteromeric complex with subunit A (HTR3A) displays the full functional features of this receptor. [provided by RefSeq, Aug 2011]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000260191
  • ENSP00000260191
  • ENSG00000149305
  • ENST00000537778
  • ENSP00000443118

Symbol
  • 5-HT3B
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
molecular function
0.86
protein domain
0.85
gene perturbation
0.62
phenotype
0.59
disease
0.57


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 45.81   (req: < 5)
Gene RIFs: 49   (req: <= 3)
Antibodies: 160   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 45.81   (req: >= 5)
Gene RIFs: 49   (req: > 3)
Antibodies: 160   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 7
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 6
Pathways (5)
Neuronal System (R-HSA-112316)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Neuronal System
Reactome
Neurotransmitter receptors and postsynaptic signal transmission
Reactome
Transmission across Chemical Synapses
Name
Explore in Pharos
Explore in Source
Neuronal System
Neurotransmitter receptors and postsynaptic signal transmission
Transmission across Chemical Synapses
Protein-Protein Interactions (72)
1 – 10 of 72
HTR3A
Tclin
Family: IC
Novelty: 0.00035394
Score: 0.941
Data Source: Reactome,STRINGDB
HTR1E
Tchem
Family: GPCR
Novelty: 0.02388691
Score: 0.743
Data Source: STRINGDB
GRIN3A
Tclin
Family: IC
Novelty: 0.01290061
Score: 0.741
Data Source: STRINGDB
HTR5A
Tchem
Family: GPCR
Novelty: 0.01826019
Score: 0.737
Data Source: STRINGDB
GRIN2C
Tclin
Family: IC
Novelty: 0.00588631
Score: 0.692
Data Source: STRINGDB
HTR7
Tclin
Family: GPCR
Novelty: 0.00190476
Score: 0.671
Data Source: STRINGDB
HTR1B
Tclin
Family: GPCR
Novelty: 0.00089155
Score: 0.665
Data Source: STRINGDB
GRIA4
Tclin
Family: IC
Novelty: 0.00363124
Score: 0.664
Data Source: STRINGDB
GRIN3B
Tclin
Family: IC
Novelty: 0.03867696
Score: 0.656
Data Source: STRINGDB
ATP6AP1
Tchem
Family: Enzyme
Novelty: 0.00194262
Score: 0.654
Data Source: STRINGDB
Publication Statistics
PubMed Score  45.81

PubMed score by year
PubTator Score  53.06

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILD
1-70
VDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSS
70-140
GTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELL
140-210
SVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVG
210-280
YTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADR
280-350
PRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSY
350-420
LFMLGIYTITLCSLWALWGGV
420-441
MLSSVMAPLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKATTVYLDLFVHAILDVDAENQILKTSVWYQEVWNDEFLSWNSSMFDEIREISLPLSAIWAPDIIINEFVDIERYPDLPYVYVNSSGTIENYKPIQVVSACSLETYAFPFDVQNCSLTFKSILHTVEDVDLAFLRSPEDIQHDKKAFLNDSEWELLSVSSTYSILQSSAGGFAQIQFNVVMRRHPLVYVVSLLIPSIFLMLVDLGSFYLPPNCRARIVFKTSVLVGYTVFRVNMSNQVPRSVGSTPLIGHFFTICMAFLVLSLAKSIVLVKFLHDEQRGGQEQPFLCLRGDTDADRPRVEPRAQRAVVTESSLYGEHLAQPGTLKEVWSQLQSISNYLQTQDQTDQQEAEWLVLLSRFDRLLFQSYLFMLGIYTITLCSLWALWGGV