You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
GADD45G
Growth arrest and DNA damage-inducible protein GADD45 gamma

Protein Summary
Description
Involved in the regulation of growth and apoptosis. Mediates activation of stress-responsive MTK1/MEKK4 MAPKKK. This gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000252506
  • ENSP00000252506
  • ENSG00000130222

Symbol
  • CR6
  • DDIT2
  • CR6
  • DDIT2
  • GRP17
  • GADD45gamma
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
gene perturbation
1
PubMedID
0.96
transcription factor binding site profile
0.96
virus perturbation
0.88
histone modification site profile
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 308.43   (req: < 5)
Gene RIFs: 32   (req: <= 3)
Antibodies: 732   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 308.43   (req: >= 5)
Gene RIFs: 32   (req: > 3)
Antibodies: 732   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 9
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (2)
1 – 2 of 2
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (34)
Items per page:
1 – 5 of 22
Data Source
Name
Explore in Pharos
Explore in Source
KEGG
Non-small cell lung cancer
KEGG
Chronic myeloid leukemia
KEGG
Gastric cancer
KEGG
Melanoma
KEGG
Cell cycle
Name
Explore in Pharos
Explore in Source
Non-small cell lung cancer
Chronic myeloid leukemia
Gastric cancer
Melanoma
Cell cycle
Gene Ontology Terms (11)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Protein-Protein Interactions (36)
1 – 10 of 36
MAP3K4
Tbio
Family: Kinase
Novelty: 0.02920916
p_int: 0.999999964
p_ni: 3.6e-8
Score: 0.986
Data Source: BioPlex,STRINGDB
GADD45B
Tbio
Novelty: 0.0060419
Score: 0.949
Data Source: STRINGDB
MAP2K6
Tchem
Family: Kinase
Novelty: 0.00880457
Score: 0.942
Data Source: STRINGDB
GADD45A
Tbio
Novelty: 0.00236467
Score: 0.939
Data Source: STRINGDB
PCNA
Tchem
Novelty: 0.00995674
Score: 0.917
Data Source: STRINGDB
CCNB1
Tchem
Novelty: 0.00068627
Score: 0.912
Data Source: STRINGDB
MAP2K3
Tchem
Family: Kinase
Novelty: 0.00438772
Score: 0.908
Data Source: STRINGDB
CDK1
Tchem
Family: Kinase
Novelty: 0.00049984
Score: 0.891
Data Source: STRINGDB
TP53
Tchem
Family: TF
Novelty: 0.00002203
Score: 0.886
Data Source: STRINGDB
CCNB2
Tbio
Novelty: 0.01021878
Score: 0.856
Data Source: STRINGDB
Publication Statistics
PubMed Score  308.43

PubMed score by year
PubTator Score  34.53

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEG
1-70
DIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSL
70-140
FCEESRSVNDWVPSITLPE
140-159
MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE