You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
KAT7
Histone acetyltransferase KAT7

Protein Summary
Description
Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Involved in H3K14 (histone H3 lysine 14) acetylation and cell proliferation (By similarity). Through chromatin acetylation it may regulate DNA replication and act as a coactivator of TP53-dependent transcription. Acts as a coactivator of the licensing factor CDT1 (PubMed:18832067). Specifically represses AR-mediated transcription. The protein encoded by this gene is part of the multimeric HBO1 complex, which possesses histone H4-specific acetyltransferase activity. This activity is required for functional replication origins and is involved in transcriptional activation of some genes. In both cases, the acetylation of histone H4 helps unfold chromatin so that the DNA can be accessed and replicated or transcribed. [provided by RefSeq, Oct 2016]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000259021
  • ENSP00000259021
  • ENSG00000136504
  • ENST00000424009
  • ENSP00000398961
  • ENST00000454930
  • ENSP00000413415
  • ENST00000509773
  • ENSP00000424577
  • ENST00000510819
  • ENSP00000423385

Symbol
  • HBO1
  • HBOa
  • MYST2
  • HBO1
  • HBOA
  • MYST2
  • ZC2HC7
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
drug perturbation
0.99
transcription factor binding site profile
0.94
histone modification site profile
0.84
disease perturbation
0.83
cell type or tissue
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.5   (req: < 5)
Gene RIFs: 38   (req: <= 3)
Antibodies: 337   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 50.5   (req: >= 5)
Gene RIFs: 38   (req: > 3)
Antibodies: 337   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 23
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (9)
Chromatin modifying enzymes (R-HSA-3247509)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Chromatin modifying enzymes
Reactome
Chromatin organization
Reactome
HATs acetylate histones
Name
Explore in Pharos
Explore in Source
Chromatin modifying enzymes
Chromatin organization
HATs acetylate histones
Gene Ontology Terms (28)
Items per page:
10
1 – 7 of 7
GO Term
Evidence
Assigned by
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Mutant Phenotype (IMP)
CAFA
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Alignment (ISA)
NTNU_SB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (128)
1 – 10 of 128
JADE1
Tbio
Family: Epigenetic
Novelty: 0.08873031
p_int: 1
Score: 0.995
Data Source: BioPlex,Reactome,STRINGDB
MEAF6
Tbio
Novelty: 0.2575873
p_int: 1
Score: 0.995
Data Source: BioPlex,Reactome,STRINGDB
JADE2
Tbio
Family: Epigenetic
Novelty: 0.47295209
p_int: 0.999999998
p_ni: 1e-9
p_wrong: 1e-9
Score: 0.992
Data Source: BioPlex,STRINGDB
JADE3
Tbio
Family: Epigenetic
Novelty: 0.69709544
p_int: 0.999999992
p_ni: 5e-9
p_wrong: 3e-9
Score: 0.993
Data Source: BioPlex,STRINGDB
BRPF3
Tchem
Family: Epigenetic
Novelty: 0.22263451
p_int: 0.999999956
p_ni: 3.3e-8
p_wrong: 1.2e-8
Score: 0.99
Data Source: BioPlex,STRINGDB
BRD1
Tchem
Family: Epigenetic
Novelty: 0.00072503
p_int: 0.99999629
p_ni: 8.8e-8
p_wrong: 0.000003622
Score: 0.995
Data Source: BioPlex,STRINGDB
ING5
Tbio
Family: Epigenetic
Novelty: 0.03831116
p_int: 0.999993828
p_ni: 0.0000058
p_wrong: 3.71e-7
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
ING4
Tbio
Family: Epigenetic
Novelty: 0.01571567
Score: 0.991
Data Source: Reactome,STRINGDB
BRPF1
Tchem
Family: Epigenetic
Novelty: 0.00091567
Score: 0.907
Data Source: STRINGDB
AR
Tclin
Family: NR
Novelty: 0.00013834
Score: 0.897
Data Source: STRINGDB
Publication Statistics
PubMed Score  50.50

PubMed score by year
PubTator Score  43.13

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVRNLQSFGTEEP
1-70
AYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDI
70-140
DISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCP
140-210
LYHNLSADECKVRAQSRDKQIEERMLSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQK
210-280
EKYMEHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTW
280-350
YHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQN
350-420
LCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKML
420-490
IDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQ
490-560
ALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
560-611
MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLSQSSQDSSPVRNLQSFGTEEPAYSTRRVTRSQQQPTPVTPKKYPLRQTRSSGSETEQVVDFSDRETKNTADHDESPPRTPTGNAPSSESDIDISSPNVSHDESIAKDMSLKDSGSDLSHRPKRRRFHESYNFNMKCPTPGCNSLGHLTGKHERHFSISGCPLYHNLSADECKVRAQSRDKQIEERMLSHRQDDNNRHATRHQAPTERQLRYKEKVAELRKKRNSGLSKEQKEKYMEHRQTYGNTREPLLENLTSEYDLDLFRRAQARASEDLEKLRLQGQITEGSNMIKTIAFGRYELDTWYHSPYPEEYARLGRLYMCEFCLKYMKSQTILRRHMAKCVWKHPPGDEIYRKGSISVFEVDGKKNKIYCQNLCLLAKLFLDHKTLYYDVEPFLFYVMTEADNTGCHLIGYFSKEKNSFLNYNVSCILTMPQYMRQGYGKMLIDFSYLLSKVEEKVGSPERPLSDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT