You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
VENTX
Homeobox protein VENTX

Protein Summary
Description
May be involved in ventralization. This gene encodes a member of the Vent family of homeodomain proteins. The encoded protein may function as a transcriptional repressor and be involved in mesodermal patterning and hemopoietic stem cell maintenance. Multiple pseudogenes exist for this gene. A transcribed pseudogene located on chromosome X may lead to antigen production in certain melanomas. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000325980
  • ENSP00000357556
  • ENSG00000151650

Symbol
  • HPX42B
  • VENTX2
  • NA88A
  • HPX42B
  • VENTX2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
microRNA
0.71
tissue sample
0.62
cell line
0.49
protein domain
0.41
biological term
0.37


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.81   (req: < 5)
Gene RIFs: 9   (req: <= 3)
Antibodies: 156   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 10.81   (req: >= 5)
Gene RIFs: 9   (req: > 3)
Antibodies: 156   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (27)
1 – 10 of 27
AES
Tbio
Novelty: 0.00659051
p_int: 0.998204709
p_ni: 0.00175632
p_wrong: 0.000038971
Score: 0.875
Data Source: BioPlex,STRINGDB
TLE4
Tbio
Novelty: 0.02737837
p_int: 0.991807614
p_ni: 0.008192386
Score: 0.859
Data Source: BioPlex,STRINGDB
TLE1
Tbio
Novelty: 0.00854022
p_int: 0.959429964
p_ni: 0.040570036
Score: 0.314
Data Source: BioPlex,STRINGDB
TLE3
Tbio
Novelty: 0.02798931
p_int: 0.911572723
p_ni: 0.088427277
Score: 0.228
Data Source: BioPlex,STRINGDB
DPRX
Tdark
Family: TF
Novelty: 0.16973126
Score: 0.758
Data Source: STRINGDB
ARGFX
Tdark
Family: TF
Novelty: 0.6779661
Score: 0.743
Data Source: STRINGDB
DUXA
Tdark
Family: TF
Novelty: 0.25104603
Score: 0.722
Data Source: STRINGDB
CHRD
Tbio
Novelty: 0.00426792
Score: 0.7
Data Source: STRINGDB
UTF1
Tbio
Novelty: 0.02642497
Score: 0.68
Data Source: STRINGDB
WNT8A
Tbio
Novelty: 0.02431839
Score: 0.652
Data Source: STRINGDB
Publication Statistics
PubMed Score  10.81

PubMed score by year
PubTator Score  8.4

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSS
1-70
NLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQ
70-140
NRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQ
140-210
EALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF
210-258
MRLSSSPPRGPQQLSSFGSVDWLSQSSCSGPTHTPRPADFSLGSLPGPGQTSGAREPPQAVSIKEAAGSSNLPAPERTMAGLSKEPNTLRAPRVRTAFTMEQVRTLEGVFQHHQYLSPLERKRLAREMQLSEVQIKTWFQNRRMKHKRQMQDPQLHSPFSGSLHAPPAFYSTSSGLANGLQLLCPWAPLSGPQALMLPPGSFWGLCQVAQEALASAGASCCGQPLASHPPTPGRPSLGPALSTGPRGLCAMPQTGDAF