You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SNUPN
Snurportin-1

Protein Summary
Description
Functions as an U snRNP-specific nuclear import adapter. Involved in the trimethylguanosine (m3G)-cap-dependent nuclear import of U snRNPs. Binds specifically to the terminal m3G-cap U snRNAs. The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. The protein encoded by this gene interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor. Alternatively spliced transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000308588
  • ENSP00000309831
  • ENSG00000169371
  • ENST00000564644
  • ENSP00000454852
  • ENST00000564675
  • ENSP00000458053
  • ENST00000567134
  • ENSP00000456224

Symbol
  • RNUT1
  • SPN1
  • KPNBL
  • RNUT1
  • Snurportin1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.98
transcription factor binding site profile
0.79
interacting protein
0.77
tissue sample
0.7
histone modification site profile
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.9   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 178   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 18.9   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 178   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (11)
1 – 5 of 11
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (4)
Metabolism of RNA (R-HSA-8953854)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of RNA
Reactome
Metabolism of non-coding RNA
Reactome
snRNP Assembly
Name
Explore in Pharos
Explore in Source
Metabolism of RNA
Metabolism of non-coding RNA
snRNP Assembly
Gene Ontology Terms (8)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (101)
1 – 10 of 101
SNRPB2
Tdark
Novelty: 0.29045643
p_int: 0.999972153
p_ni: 0.000027287
p_wrong: 5.6e-7
Score: 0.196
Data Source: BioPlex,STRINGDB
SNRPA1
Tbio
Novelty: 0.02038744
p_int: 0.999909791
p_ni: 0.000090209
Score: 0.744
Data Source: BioPlex,STRINGDB
PDP1
Tbio
Family: Enzyme
Novelty: 0.00427629
p_int: 0.999563548
p_ni: 0.000436452
Score: 0.29
Data Source: BioPlex,STRINGDB
SNRPE
Tbio
Novelty: 0.00150118
p_int: 0.998418216
p_ni: 0.001581784
Score: 0.967
Data Source: BioPlex,STRINGDB
SNRPN
Tbio
Novelty: 0.00241221
p_int: 0.989614676
p_ni: 0.01030817
p_wrong: 0.000077154
Score: 0.626
Data Source: BioPlex,STRINGDB
TOE1
Tbio
Novelty: 0.03701419
p_int: 0.97555527
p_ni: 0.02444473
Score: 0.858
Data Source: BioPlex,STRINGDB
KPNB1
Tbio
Novelty: 0.02119848
Score: 0.993
Data Source: STRINGDB
XPO1
Tclin
Novelty: 0.00065429
Score: 0.992
Data Source: STRINGDB
SNRPD1
Tbio
Novelty: 0.00310501
Score: 0.991
Data Source: STRINGDB
DDX20
Tbio
Family: Enzyme
Novelty: 0.02595469
Score: 0.966
Data Source: STRINGDB
Publication Statistics
PubMed Score  18.90

PubMed score by year
PubTator Score  21.23

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDW
1-70
TGMESEEENKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTS
70-140
AYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHS
140-210
KLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPY
210-280
MVSDVLGVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLSTPKLKGSSHS
280-350
PDHPGCLMEN
350-360
MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVNHARRLAEDDWTGMESEEENKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWIVVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVNQTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPESLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLSTPKLKGSSHSPDHPGCLMEN