You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SEC31A
Protein transport protein Sec31A

Protein Summary
Description
Component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER) (PubMed:10788476). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules (By similarity). The protein encoded by this gene shares similarity with the yeast Sec31 protein, and is a component of the outer layer of the coat protein complex II (COPII). The encoded protein is involved in vesicle budding from the endoplasmic reticulum (ER) and contains multiple WD repeats near the N-terminus and a proline-rich region in the C-terminal half. It associates with the protein encoded by the SEC13 homolog, nuclear pore and COPII coat complex component (SEC13), and is required for ER-Golgi transport. Monoubiquitylation of this protein by CUL3-KLHL12 was found to regulate the size of COPII coats to accommodate unusually shaped cargo. Alternative splicing results in multiple ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000311785
  • ENSP00000309070
  • ENSG00000138674
  • ENST00000348405
  • ENSP00000337602
  • ENST00000355196
  • ENSP00000347329
  • ENST00000395310
  • ENSP00000378721
  • ENST00000443462
  • ENSP00000408027
  • ENST00000448323
  • ENSP00000400926
  • ENST00000500777
  • ENSP00000421464
  • ENST00000505984
  • ENSP00000424451
  • ENST00000508502
  • ENSP00000424635
  • ENST00000509142
  • ENSP00000426569
  • ENST00000513858
  • ENSP00000426886

Symbol
  • KIAA0905
  • SEC31L1
  • ABP125
  • ABP130
  • HSPC275
  • HSPC334
  • SEC31L1
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.99
ligand (protein) perturbation
0.83
biological process
0.82
cellular component
0.81
interacting protein
0.76


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15.02   (req: < 5)
Gene RIFs: 18   (req: <= 3)
Antibodies: 130   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 15.02   (req: >= 5)
Gene RIFs: 18   (req: > 3)
Antibodies: 130   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 11
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (26)
Adaptive Immune System (R-HSA-1280218)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 16
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Adaptive Immune System
Reactome
Antigen Presentation: Folding, assembly and peptide loading of class I MHC
Reactome
Asparagine N-linked glycosylation
Reactome
COPII-mediated vesicle transport
Reactome
Class I MHC mediated antigen processing & presentation
Name
Explore in Pharos
Explore in Source
Adaptive Immune System
Antigen Presentation: Folding, assembly and peptide loading of class I MHC
Asparagine N-linked glycosylation
COPII-mediated vesicle transport
Class I MHC mediated antigen processing & presentation
Protein-Protein Interactions (270)
1 – 10 of 270
SCYL1
Tbio
Family: Kinase
Novelty: 0.0175276
p_int: 1
Score: 0.948
Data Source: BioPlex,STRINGDB
TFG
Tbio
Novelty: 0.00472184
p_int: 0.999660019
p_ni: 0.000339981
Score: 0.984
Data Source: BioPlex,Reactome,STRINGDB
SEC13
Tbio
Novelty: 0.0100577
p_int: 0.999093127
p_ni: 0.000906873
Score: 0.999
Data Source: BioPlex,Reactome,STRINGDB
NOP14
Tbio
Novelty: 0.0868636
p_int: 0.998814873
p_ni: 0.001185127
Score: 0.202
Data Source: BioPlex,STRINGDB
SEC23IP
Tbio
Novelty: 0.13247818
p_int: 0.996415007
p_ni: 0.003584993
Score: 0.977
Data Source: BioPlex,Reactome,STRINGDB
NOC4L
Tdark
Novelty: 0.37037037
p_int: 0.996188114
p_ni: 0.003811884
p_wrong: 2e-9
Score: 0.2
Data Source: BioPlex,STRINGDB
GNPDA1
Tbio
Family: Enzyme
Novelty: 0.01074918
p_int: 0.977411954
p_ni: 0.022588046
Score: 0.234
Data Source: BioPlex,STRINGDB
CCDC88A
Tbio
Novelty: 0.01149743
p_int: 0.844100842
p_ni: 0.155899158
Score: 0.175
Data Source: BioPlex,STRINGDB
SEC23A
Tbio
Novelty: 0.0358158
Score: 0.999
Data Source: Reactome,STRINGDB
SEC24B
Tbio
Novelty: 0.01524602
Score: 0.998
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  15.02

PubMed score by year
PubTator Score  23.83

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSCATFSSSHRYH
1-70
KLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDKHTGPVRALDVNIFQTNLVAS
70-140
GANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQVQHILASASPSGRATVWDLRKNEPIIKVSDH
140-210
SNRMHCSGLAWHPDVATQMVLASEDDRLPVIQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCG
210-280
KDAKILCSNPNTGEVLYELPTNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLS
280-350
SSFGNLDPFGTGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQ
350-420
QQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVNFEDDSRGKYL
420-490
ELLGYRKEDLGKKIALALNKVDGANVALKDSDQVAQSDGEESPAAEEQLLGEHIKEEKEESEFLPSSGGT
490-560
FNISVSGDIDGLITQALLTGNFESAVDLCLHDNRMADAIILAIAGGQELLARTQKKYFAKSQSKITRLIT
560-630
AVVMKNWKEIVESCDLKNWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEK
630-700
LVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFL
700-770
PDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPP
770-840
PGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQPYQPAQPYPFGTGGSAMYRPQQPVAPPTSNAYPNT
840-910
PYISSASSYTGQSQLYAAQHQASSPTSSPATSFPPPPSSGASFQHGGPGAPPSSSAYALPPGTTGTLPAA
910-980
SELPASQRTGPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQS
980-1050
SFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILK
1050-1120
TTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHT
1120-1190
HIVSTSNFSETSAFMPVLKVVLTQANKLGV
1190-1220
MKLKEVDRTAMQAWSPAQNHPIYLATGTSAQQLDATFSTNASLEIFELDLSDPSLDMKSCATFSSSHRYHKLIWGPYKMDSKGDVSGVLIAGGENGNIILYDPSKIIAGDKEVVIAQNDKHTGPVRALDVNIFQTNLVASGANESEIYIWDLNNFATPMTPGAKTQPPEDISCIAWNRQVQHILASASPSGRATVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDVATQMVLASEDDRLPVIQMWDLRFASSPLRVLENHARGILAIAWSMADPELLLSCGKDAKILCSNPNTGEVLYELPTNTQWCFDIQWCPRNPAVLSAASFDGRISVYSIMGGSTDGLRQKQVDKLSSSFGNLDPFGTGQPLPPLQIPQQTAQHSIVLPLKKPPKWIRRPVGASFSFGGKLVTFENVRMPSHQGAEQQQQQHHVFISQVVTEKEFLSRSDQLQQAVQSQGFINYCQKKIDASQTEFEKNVWSFLKVNFEDDSRGKYLELLGYRKEDLGKKIALALNKVDGANVALKDSDQVAQSDGEESPAAEEQLLGEHIKEEKEESEFLPSSGGTFNISVSGDIDGLITQALLTGNFESAVDLCLHDNRMADAIILAIAGGQELLARTQKKYFAKSQSKITRLITAVVMKNWKEIVESCDLKNWREALAAVLTYAKPDEFSALCDLLGTRLENEGDSLLQTQACLCYICAGNVEKLVACWTKAQDGSHPLSLQDLIEKVVILRKAVQLTQAMDTSTVGVLLAAKMSQYANLLAAQGSIAAALAFLPDNTNQPNIMQLRDRLCRAQGEPVAGHESPKIPYEKQQLPKGRPGPVAGHHQMPRVQTQQYYPHGENPPPPGFIMHGNVNPNAAGQLPTSPGHMHTQVPPYPQPQPYQPAQPYPFGTGGSAMYRPQQPVAPPTSNAYPNTPYISSASSYTGQSQLYAAQHQASSPTSSPATSFPPPPSSGASFQHGGPGAPPSSSAYALPPGTTGTLPAASELPASQRTGPQNGWNDPPALNRVPKKKKMPENFMPPVPITSPIMNPLGDPQSQMLQQQPSAPVPLSSQSSFPQPHLPGGQPFHGVQQPLGQTGMPPSFSKPNIEGAPGAPIGNTFQHVQSLPTKKITKKPIPDEHLILKTTFEDLIQRCLSSATDPQTKRKLDDASKRLEFLYDKLREQTLSPTITSGLHNIARSIETRNYSEGLTMHTHIVSTSNFSETSAFMPVLKVVLTQANKLGV