You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RNF8
E3 ubiquitin-protein ligase RNF8

Protein Summary
Description
E3 ubiquitin-protein ligase that plays a key role in DNA damage signaling via 2 distinct roles: by mediating the 'Lys-63'-linked ubiquitination of histones H2A and H2AX and promoting the recruitment of DNA repair proteins at double-strand breaks (DSBs) sites, and by catalyzing 'Lys-48'-linked ubiquitination to remove target proteins from DNA damage sites. Following DNA DSBs, it is recruited to the sites of damage by ATM-phosphorylated MDC1 and catalyzes the 'Lys-63'-linked ubiquitination of histones H2A and H2AX, thereby promoting the formation of TP53BP1 and BRCA1 ionizing radiation-induced foci (IRIF). Also controls the recruitment of UIMC1-BRCC3 (RAP80-BRCC36) and PAXIP1/PTIP to DNA damage sites. Also recruited at DNA interstrand cross-links (ICLs) sites and catalyzes 'Lys-63'-linked ubiquitination of histones H2A and H2AX, leading to recruitment of FAAP20/C1orf86 and Fanconi anemia (FA) complex, followed by interstrand cross-link repair. H2A ubiquitination also mediates the ATM-dep ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000229866
  • ENSP00000229866
  • ENSG00000112130
  • ENST00000373479
  • ENSP00000362578
  • ENST00000469731
  • ENSP00000418879

Symbol
  • KIAA0646
  • hRNF8
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.96
biological process
0.95
virus perturbation
0.92
protein domain
0.85
microRNA
0.82


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 73.94   (req: < 5)
Gene RIFs: 61   (req: <= 3)
Antibodies: 309   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 73.94   (req: >= 5)
Gene RIFs: 61   (req: > 3)
Antibodies: 309   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 28
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (98)
Cell Cycle (R-HSA-1640170)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 12
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Cell Cycle
Reactome
Cell Cycle Checkpoints
Reactome
DNA Double Strand Break Response
Reactome
DNA Double-Strand Break Repair
Reactome
DNA Repair
Name
Explore in Pharos
Explore in Source
Cell Cycle
Cell Cycle Checkpoints
DNA Double Strand Break Response
DNA Double-Strand Break Repair
DNA Repair
Gene Ontology Terms (35)
Items per page:
10
1 – 8 of 8
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Physical Interaction (IPI)
IntAct
Inferred from Physical Interaction (IPI)
UniProtKB
Inferred from Electronic Annotation (IEA)
UniProtKB-UniRule
Protein-Protein Interactions (172)
1 – 10 of 172
RNF168
Tbio
Family: Enzyme
Novelty: 0.02518607
Score: 0.993
Data Source: Reactome,STRINGDB
MDC1
Tbio
Novelty: 0.00704247
Score: 0.991
Data Source: Reactome,STRINGDB
TP53BP1
Tbio
Family: Epigenetic
Novelty: 0.0017892
Score: 0.99
Data Source: Reactome,STRINGDB
UBE2N
Tbio
Novelty: 0.00723255
Score: 0.986
Data Source: Reactome,STRINGDB
BRCA1
Tchem
Novelty: 0.00014684
Score: 0.986
Data Source: STRINGDB
UIMC1
Tbio
Novelty: 0.0201143
Score: 0.985
Data Source: Reactome,STRINGDB
ATM
Tchem
Family: Kinase
Novelty: 0.00023967
Score: 0.985
Data Source: Reactome,STRINGDB
H2AFX
Tbio
Novelty: 0.00052244
Score: 0.984
Data Source: Reactome,STRINGDB
BARD1
Tbio
Novelty: 0.00770731
Score: 0.978
Data Source: STRINGDB
UBE2V2
Tbio
Novelty: 0.01761532
Score: 0.973
Data Source: Reactome,STRINGDB
Publication Statistics
PubMed Score  73.94

PubMed score by year
PubTator Score  70.49

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNP
1-70
EGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKN
70-140
DQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTAL
140-210
EPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKG
210-280
NSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWAL
280-350
MEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAH
350-420
SFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF
420-485
MGEPGFFVTGDRAGGRSWCLRRVGMSAGWLLLEDGCEVTVGRGFGVTYQLVSKICPLMISRNHCVLKQNPEGQWTIMDNKSLNGVWLNRARLEPLRVYSIHQGDYIQLGVPLENKENAEYEYEVTEEDWETIYPCLSPKNDQMIEKNKELRTKRKFSLDELAGPGAEGPSNLKSKINKVSCESGQPVKSQGKGEVASTPSDNLDPKLTALEPSKTTGAPIYPGFPKVTEVHHEQKASNSSASQRSLQMFKVTMSRILRLKIQMQEKHEAVMNVKKQTQKGNSKKVVQMEQELQDLQSQLCAEQAQQQARVEQLEKTFQEEEQHLQGLEIAQGEKDLKQQLAQALQEHWALMEELNRSKKDFEAIIQAKNKELEQTKEEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIECPICRKDIKSKTYSLVLDNCINKMVNNLSSEVKERRIVLIRERKAKRLF