You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
OR2J3
Olfactory receptor 2J3

Protein Summary
Description
Odorant receptor involved in the detection of the flavor compound cis-3-hexen-1-ol (C3HEX), a compound typically described as 'green grassy' or the smell of 'cut grass'. This gene encodes a G-protein-coupled receptor (GPCR) that functions as an olfactory receptor. Olfactory receptors interact with odorant molecules in the nose to initiate a neuronal response that triggers the perception of a smell. The protein encoded by this gene responds to cis-3-hexen-1-ol, which is released by wounded plants, including cut grass. This gene is situated in a cluster of similar olfactory-receptor coding genes on chromosome 6. [provided by RefSeq, May 2013]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000377169
  • ENSP00000366374
  • ENSG00000204701
  • ENST00000383651
  • ENSP00000373147
  • ENSG00000206522
  • ENST00000414140
  • ENSP00000390144
  • ENSG00000232178
  • ENST00000418630
  • ENSP00000400546
  • ENSG00000233618
  • ENST00000419260
  • ENSP00000408783
  • ENSG00000229866
  • ENST00000428081
  • ENSP00000388392
  • ENSG00000226271
  • ENST00000430478
  • ENSP00000388205
  • ENSG00000233636

Symbol
  • 6M1-3
  • OR6-6
  • C3HEXS
  • OR6-16
  • ORL671
  • HS6M1-3
  • OR6.3.6
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
cell type or tissue
0.85
cell line
0.5
tissue sample
0.46
protein domain
0.41
microRNA
0.35


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.09   (req: < 5)
Gene RIFs: 3   (req: <= 3)
Antibodies: 83   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.09   (req: >= 5)
Gene RIFs: 3   (req: > 3)
Antibodies: 83   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (7)
G alpha (s) signalling events (R-HSA-418555)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
G alpha (s) signalling events
Reactome
GPCR downstream signalling
Reactome
Olfactory Signaling Pathway
Reactome
Signal Transduction
Reactome
Signaling by GPCR
Name
Explore in Pharos
Explore in Source
G alpha (s) signalling events
GPCR downstream signalling
Olfactory Signaling Pathway
Signal Transduction
Signaling by GPCR
Protein-Protein Interactions (29)
1 – 10 of 29
RTP2
Tbio
Novelty: 0.13129103
Score: 0.94
Data Source: STRINGDB
RTP1
Tbio
Novelty: 0.04761905
Score: 0.921
Data Source: STRINGDB
REEP1
Tbio
Novelty: 0.02999447
Score: 0.921
Data Source: STRINGDB
GNAL
Tbio
Novelty: 0.0277957
Score: 0.917
Data Source: STRINGDB
GNB1
Tbio
Novelty: 0.04716243
Score: 0.9
Data Source: STRINGDB
REEP6
Tbio
Novelty: 0.17493781
Score: 0.9
Data Source: STRINGDB
RTP3
Tbio
Novelty: 0.12230635
Score: 0.9
Data Source: STRINGDB
REEP2
Tdark
Novelty: 0.28121006
Score: 0.9
Data Source: STRINGDB
REEP4
Tbio
Novelty: 0.34354551
Score: 0.9
Data Source: STRINGDB
RTP4
Tbio
Novelty: 0.18444058
Score: 0.9
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.09

PubMed score by year
PubTator Score  47.78

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MNDDGKVNASSEGYFILVGFSNWPHLEVVIFVVVLIFYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLS
1-70
FLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTTECVLLVVMSYDRYAAVCRPLHYTVLMH
70-140
PRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFV
140-210
LIPLILILTSYGAIVRAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGKFIALF
210-280
YTVVTPSLNPLIYTLRNKVVRGAVKRLMGWE
280-311
MNDDGKVNASSEGYFILVGFSNWPHLEVVIFVVVLIFYLMTLIGNLFIIILSYLDSHLHTPMYFFLSNLSFLDLCYTTSSIPQLLVNLWGPEKTISYAGCMIQLYFVLALGTTECVLLVVMSYDRYAAVCRPLHYTVLMHPRFCHLLAVASWVSGFTNSALHSSFTFWVPLCGHRQVDHFFCEVPALLRLSCVDTHVNELTLMITSSIFVLIPLILILTSYGAIVRAVLRMQSTTGLQKVFGTCGAHLMAVSLFFIPAMCIYLQPPSGNSQDQGKFIALFYTVVTPSLNPLIYTLRNKVVRGAVKRLMGWE