You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
RFPL3
Ret finger protein-like 3

Protein Summary
Description
(Microbial infection) Stimulates the activity of Human Immunodeficiency Virus 1/HIV-1 pre-integration complex.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000249007
  • ENSP00000249007
  • ENSG00000128276
  • ENST00000397468
  • ENSP00000380609

Symbol
  • RNF120
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.97
tissue sample
0.82
cellular component
0.75
cell line
0.55
microRNA
0.45


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.72   (req: < 5)
Gene RIFs: 6   (req: <= 3)
Antibodies: 155   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 3.72   (req: >= 5)
Gene RIFs: 6   (req: > 3)
Antibodies: 155   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Term: 1
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (3)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Electronic Annotation (IEA)
UniProtKB-KW
Protein-Protein Interactions (32)
1 – 10 of 32
RFPL1
Tdark
Novelty: 0.50955414
p_int: 1
Score: 0.693
Data Source: BioPlex,STRINGDB
RFPL2
Tdark
Novelty: 6
p_int: 1
Score: 0.291
Data Source: BioPlex,STRINGDB
ASNSD1
Tdark
Family: Enzyme
Novelty: 27
p_int: 0.999999953
p_ni: 4.3e-8
p_wrong: 4e-9
Score: 0.416
Data Source: BioPlex,STRINGDB
DAB2IP
Tbio
Novelty: 0.01636352
p_int: 0.999835042
p_ni: 0.000164958
Score: 0.381
Data Source: BioPlex,STRINGDB
TLK2
Tchem
Family: Kinase
Novelty: 0.07739026
p_int: 0.954373222
p_ni: 0.045626778
Score: 0.269
Data Source: BioPlex,STRINGDB
RFPL3S
Tdark
Novelty: 2
Score: 0.904
Data Source: STRINGDB
PAX6
Tbio
Family: TF
Novelty: 0.00078251
Score: 0.768
Data Source: STRINGDB
NARS
Tbio
Family: Enzyme
Novelty: 0.00941326
Score: 0.757
Data Source: STRINGDB
OR1N2
Tdark
Family: oGPCR
Score: 0.571
Data Source: STRINGDB
KHDC1L
Tdark
Score: 0.542
Data Source: STRINGDB
Publication Statistics
PubMed Score  3.72

PubMed score by year
PubTator Score  3.05

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MKRLSLVTTNRLSPQGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCTVCLKCINSLQKE
1-70
PHGEDLLCCCCSMVSQRNKIRPNRQLERLVSHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLI
70-140
SDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHCKGKIQLT
140-210
TELGFWTVSLRDGSRLSASTVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLR
210-280
PFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEAK
280-317
MKRLSLVTTNRLSPQGNFLPLCTFPLAVDMAALFQEASSCPVCSDYLEKPMSLECGCTVCLKCINSLQKEPHGEDLLCCCCSMVSQRNKIRPNRQLERLVSHIKELEPKLKKILQMNPRMRKFQVDMTLDADTANNFLLISDDLRSVRSGLITQNRQDLAERFDVSVCILGSPRFTCGRHYWEVDVGTSTEWDLGVCRESVHCKGKIQLTTELGFWTVSLRDGSRLSASTVPLTFLLVDRKLQRVGIFLDMGMQNVSFFDAESGSHVYTFRSVSAEEPLRPFLAPSIPPNGDQGVLSICPLMNSGTTDAPVRPGEAK