You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
NPM3
Nucleoplasmin-3

Protein Classes
Protein Summary
Description
May act as a chaperone. The protein encoded by this gene is related to the nuclear chaperone phosphoproteins, nucleoplasmin and nucleophosmin. This protein is strongly expressed in diverse cell types where it localizes primarily to the nucleus. Based on its similarity to nucleoplasmin and nucleophosmin, this protein likely functions as a molecular chaperone in the cell nucleus. [provided by RefSeq, Oct 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000370110
  • ENSP00000359128
  • ENSG00000107833

Symbol
  • PORMIN
  • TMEM123
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
histone modification site profile
0.77
small molecule perturbation
0.75
drug perturbation
0.71
PubMedID
0.69
tissue sample
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.13   (req: < 5)
Gene RIFs: 5   (req: <= 3)
Antibodies: 113   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 5.13   (req: >= 5)
Gene RIFs: 5   (req: > 3)
Antibodies: 113   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Gene Ontology Terms (11)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Protein-Protein Interactions (39)
1 – 10 of 39
NPM1
Tbio
Novelty: 0.00069185
p_int: 0.98504155
p_ni: 0.014957366
p_wrong: 0.000001083
Score: 0.741
Data Source: BioPlex,STRINGDB
NPM2
Tbio
Novelty: 0.05245308
p_int: 0.984036617
p_ni: 0.015566099
p_wrong: 0.000397284
Score: 0.993
Data Source: BioPlex,STRINGDB
FKBP15
Tbio
Novelty: 0.07897873
Score: 0.848
Data Source: STRINGDB
EEF1D
Tbio
Novelty: 0.0317015
Score: 0.689
Data Source: STRINGDB
DUT
Tchem
Family: Enzyme
Novelty: 0.003979
Score: 0.686
Data Source: STRINGDB
H2AFZ
Tbio
Novelty: 0.00281312
Score: 0.662
Data Source: STRINGDB
H2AFV
Tbio
Novelty: 0.06257527
Score: 0.645
Data Source: STRINGDB
TRIM55
Tbio
Novelty: 0.09248041
Score: 0.626
Data Source: STRINGDB
CHD1
Tbio
Family: Epigenetic
Novelty: 0.00683301
Score: 0.625
Data Source: STRINGDB
FGF8
Tbio
Novelty: 0.00182042
Score: 0.615
Data Source: STRINGDB
Publication Statistics
PubMed Score  5.13

PubMed score by year
PubTator Score  6.64

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLC
1-70
LTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIV
70-140
TMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP
140-178
MAAGTAAALAFLSQESRTRAGGVGGLRVPAPVTMDSFFFGCELSGHTRSFTFKVEEEDDAEHVLALTMLCLTEGAKDECNVVEVVARNHDHQEIAVPVANLKLSCQPMLSLDDFQLQPPVTFRLKSGSGPVRITGRHQIVTMSNDVSEEESEEEEEDSDEEEVELCPILPAKKQGGRP