You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
CSDE1
Cold shock domain-containing protein E1

Protein Summary
Description
RNA-binding protein. Required for internal initiation of translation of human rhinovirus RNA. May be involved in translationally coupled mRNA turnover. Implicated with other RNA-binding proteins in the cytoplasmic deadenylation/translational and decay interplay of the FOS mRNA mediated by the major coding-region determinant of instability (mCRD) domain.
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000261443
  • ENSP00000261443
  • ENSG00000009307
  • ENST00000339438
  • ENSP00000342408
  • ENST00000358528
  • ENSP00000351329
  • ENST00000369530
  • ENSP00000358543
  • ENST00000438362
  • ENSP00000407724
  • ENST00000534699
  • ENSP00000432958
  • ENST00000610726
  • ENSP00000481762

Symbol
  • D1S155E
  • KIAA0885
  • NRU
  • UNR
  • UNR
  • D1S155E
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
1
interacting protein
0.97
transcription factor binding site profile
0.95
virus perturbation
0.92
kinase perturbation
0.84


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.73   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 188   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 32.73   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 188   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 5
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (5)
1 – 5 of 5
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (9)
Items per page:
10
1 – 2 of 2
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (91)
1 – 10 of 91
STRAP
Tbio
Family: Enzyme
Novelty: 0.03966134
p_int: 0.999999499
p_ni: 5.01e-7
Score: 0.966
Data Source: BioPlex,STRINGDB
FAM19A3
Tdark
Novelty: 0.43478261
p_int: 0.978418321
p_ni: 0.021581679
Data Source: BioPlex
SAMD4A
Tbio
Novelty: 0.05117077
p_int: 0.923271907
p_ni: 0.076728093
Score: 0.228
Data Source: BioPlex,STRINGDB
HSPA8
Tchem
Novelty: 0.00100906
p_int: 0.754470084
p_ni: 0.245529916
Score: 0.26
Data Source: BioPlex,STRINGDB
SYNCRIP
Tbio
Novelty: 0.02027153
Score: 0.97
Data Source: STRINGDB
YBX1
Tbio
Family: TF
Novelty: 0.00147127
Score: 0.941
Data Source: STRINGDB
DHX9
Tbio
Family: Enzyme
Novelty: 0.00143599
Score: 0.937
Data Source: STRINGDB
IGF2BP1
Tbio
Novelty: 0.01140984
Score: 0.926
Data Source: STRINGDB
HNRNPU
Tbio
Novelty: 0.0043357
Score: 0.909
Data Source: STRINGDB
PABPC1
Tbio
Novelty: 0.002455
Score: 0.871
Data Source: STRINGDB
Publication Statistics
PubMed Score  32.73

PubMed score by year
PubTator Score  33.41

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVE
1-70
FEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQVVCAVPHNLESKSPAAPGQSPTGSVCYERNGEVFYLT
70-140
YTPEDVEGNVQLETGDKINFVIDNNKHTGAVSARNIMLLKKKQARCQGVVCAMKEAFGFIERGDVVKEIF
140-210
FHYSEFKGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPSKNQN
210-280
DPLPGRIKVDFVIPKELPFGDKDTKSKVTLLEGDHVRFNISTDRRDKLERATNIEVLSNTFQFTNEAREM
280-350
GVIAAMRDGFGFIKCVDRDVRMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRNHAIRIKKLPKGTVSF
350-420
HSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVE
420-490
FSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVDSLELGD
490-560
MVEYSLSKGKGNKVSAEKVNKTHSVNGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVEEGDMKGE
560-630
VYPFGIVGMANKGDCLQKGESVKFQLCVLGQNAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLFF
630-700
HVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRL
700-770
MVLRQPRGPDNSMGFGAERKIRQAGVID
770-798
MSFDPNLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQVVCAVPHNLESKSPAAPGQSPTGSVCYERNGEVFYLTYTPEDVEGNVQLETGDKINFVIDNNKHTGAVSARNIMLLKKKQARCQGVVCAMKEAFGFIERGDVVKEIFFHYSEFKGDLETLQPGDDVEFTIKDRNGKEVATDVRLLPQGTVIFEDISIEHFEGTVTKVIPKVPSKNQNDPLPGRIKVDFVIPKELPFGDKDTKSKVTLLEGDHVRFNISTDRRDKLERATNIEVLSNTFQFTNEAREMGVIAAMRDGFGFIKCVDRDVRMFFHFSEILDGNQLHIADEVEFTVVPDMLSAQRNHAIRIKKLPKGTVSFHSHSDHRFLGTVEKEATFSNPKTTSPNKGKEKEAEDGIIAYDDCGVKLTIAFQAKDVEGSTSPQIGDKVEFSISDKQRPGQQVATCVRLLGRNSNSKRLLGYVATLKDNFGFIETANHDKEIFFHYSEFSGDVDSLELGDMVEYSLSKGKGNKVSAEKVNKTHSVNGITEEADPTIYSGKVIRPLRSVDPTQTEYQGMIEIVEEGDMKGEVYPFGIVGMANKGDCLQKGESVKFQLCVLGQNAQTMAYNITPLRRATVECVKDQFGFINYEVGDSKKLFFHVKEVQDGIELQAGDEVEFSVILNQRTGKCSACNVWRVCEGPKAVAAPRPDRLVNRLKNITLDDASAPRLMVLRQPRGPDNSMGFGAERKIRQAGVID