You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
SRSF10
Serine/arginine-rich splicing factor 10

Protein Summary
Description
Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing (PubMed:11684676, PubMed:12419250, PubMed:14765198). Seems to interfere with the U1 snRNP 5'-splice recognition of SNRNP70 (PubMed:14765198). Required for splicing repression in M-phase cells and after heat shock (PubMed:14765198). Also acts as a splicing factor that specifically promotes exon skipping during alternative splicing (PubMed:26876937). Interaction with YTHDC1, a RNA-binding protein that recognizes and binds N6-methyladenosine (m6A)-containing RNAs, prevents SRSF10 from binding to its mRNA-binding sites close to m6A-containing regions, leading to inhibit exon skipping during alternative splicing (PubMed:26876937). May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator (PubMed:12419250). This gene product is a member of the serine-arginine (SR) family of proteins, which are involved in constitu ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000343255
  • ENSP00000344149
  • ENSG00000188529
  • ENST00000344989
  • ENSP00000342913
  • ENST00000374452
  • ENSP00000363576
  • ENST00000453840
  • ENSP00000388991
  • ENST00000484146
  • ENSP00000419813
  • ENST00000492112
  • ENSP00000420195

Symbol
  • FUSIP1
  • FUSIP2
  • SFRS13A
  • TASR
  • NSSR
  • TASR
  • SRp38
  • TASR1
  • TASR2
  • FUSIP1
  • FUSIP2
  • SFRS13
  • SRrp40
  • SFRS13A
  • PPP1R149
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
interacting protein
0.93
virus perturbation
0.9
transcription factor binding site profile
0.87
ligand (protein) perturbation
0.83
microRNA
0.8


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 79.49   (req: < 5)
Gene RIFs: 11   (req: <= 3)
Antibodies: 233   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 79.49   (req: >= 5)
Gene RIFs: 11   (req: > 3)
Antibodies: 233   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 14
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (6)
Metabolism of RNA (R-HSA-8953854)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 4 of 4
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of RNA
Reactome
Processing of Capped Intron-Containing Pre-mRNA
Reactome
mRNA Splicing
Reactome
mRNA Splicing - Major Pathway
Name
Explore in Pharos
Explore in Source
Metabolism of RNA
Processing of Capped Intron-Containing Pre-mRNA
mRNA Splicing
mRNA Splicing - Major Pathway
Gene Ontology Terms (19)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Non-traceable Author Statement (NAS)
UniProtKB
Protein-Protein Interactions (188)
1 – 10 of 188
U2AF2
Tbio
Novelty: 0.00739606
p_int: 0.990000998
p_ni: 0.009999002
Score: 0.988
Data Source: BioPlex,STRINGDB
LUC7L2
Tdark
Novelty: 0.46134191
p_int: 0.987919193
p_ni: 0.012080807
Score: 0.44
Data Source: BioPlex,STRINGDB
CLK2
Tchem
Family: Kinase
Novelty: 0.36216831
p_int: 0.98248913
p_ni: 0.01751087
Score: 0.751
Data Source: BioPlex,STRINGDB
SNIP1
Tbio
Novelty: 0.0303933
p_int: 0.975614047
p_ni: 0.024385953
Score: 0.633
Data Source: BioPlex,STRINGDB
NKAPD1
Tdark
Novelty: 2.25
p_int: 0.963834473
p_ni: 0.036165526
Score: 0.221
Data Source: BioPlex,STRINGDB
SAP18
Tbio
Family: Enzyme
Novelty: 0.05845743
p_int: 0.96225494
p_ni: 0.03774506
p_wrong: 1e-9
Score: 0.786
Data Source: BioPlex,STRINGDB
SNRNP70
Tbio
Novelty: 0.00199593
p_int: 0.946654467
p_ni: 0.053345532
p_wrong: 1e-9
Score: 0.97
Data Source: BioPlex,STRINGDB
ZC3H18
Tdark
Novelty: 7
p_int: 0.91630121
p_ni: 0.08369879
Score: 0.548
Data Source: BioPlex,STRINGDB
CLK3
Tchem
Family: Kinase
Novelty: 0.02788904
p_int: 0.906368954
p_ni: 0.093631046
Score: 0.845
Data Source: BioPlex,STRINGDB
CBLL2
Tdark
Family: Enzyme
Novelty: 0.49763033
p_int: 0.904643408
p_ni: 0.095356592
Score: 0.204
Data Source: BioPlex,STRINGDB
Publication Statistics
PubMed Score  79.49

PubMed score by year
PubTator Score  45.48

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN
1-70
LDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRR
70-140
SYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSK
140-210
TDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH
210-262
MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRFKHRNRSFSRSKSNSRSRSKSQPKKEMKAKSRSRSASHTKTRGTSKTDSKTHYKSGSRYEKESRKKEPPRSKSQSRSQSRSRSKSRSRSWTSPKSSGH