You are using an outdated browser. Please upgrade your browser to improve your experience.

Tchem
NR1I2
Nuclear receptor subfamily 1 group I member 2

Protein Summary
Description
Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes. This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It i ...more
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000337940
  • ENSP00000336528
  • ENSG00000144852
  • ENST00000638727
  • ENSP00000492264
  • ENST00000640105
  • ENSP00000492881

Symbol
  • PXR
  • BXR
  • PAR
  • PRR
  • PXR
  • SAR
  • SXR
  • ONR1
  • PAR1
  • PAR2
  • PARq
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
chemical
1
co-expressed gene
1
molecular function
0.97
biological term
0.8
biological process
0.73


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1616.64   (req: < 5)
Gene RIFs: 287   (req: <= 3)
Antibodies: 380   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 1616.64   (req: >= 5)
Gene RIFs: 287   (req: > 3)
Antibodies: 380   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligands: 19
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drugs: 3
Protein Data Bank (23)
1 – 5 of 23
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (88)
Gene expression (Transcription) (R-HSA-74160)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 9
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Gene expression (Transcription)
Reactome
Generic Transcription Pathway
Reactome
Metabolism of proteins
Reactome
Nuclear Receptor transcription pathway
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Gene expression (Transcription)
Generic Transcription Pathway
Metabolism of proteins
Nuclear Receptor transcription pathway
Post-translational protein modification
Gene Ontology Terms (29)
Items per page:
10
1 – 10 of 12
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Direct Assay (IDA)
NTNU_SB
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Biological aspect of Ancestor (IBA)
GO_Central
Inferred from Sequence Alignment (ISA)
NTNU_SB
Traceable Author Statement (TAS)
ProtInc
Protein-Protein Interactions (168)
1 – 10 of 168
CYP3A4
Tclin
Family: Enzyme
Novelty: 0.00020884
Score: 0.962
Data Source: STRINGDB
NCOA1
Tchem
Family: Epigenetic
Novelty: 0.00427551
Score: 0.962
Data Source: STRINGDB
RXRA
Tclin
Family: NR
Novelty: 0.00314166
Score: 0.917
Data Source: STRINGDB
NR0B2
Tchem
Family: NR
Novelty: 0.00166432
Score: 0.881
Data Source: STRINGDB
PPIG
Tchem
Family: Enzyme
Novelty: 0.00019536
Score: 0.867
Data Source: STRINGDB
CYP7A1
Tbio
Family: Enzyme
Novelty: 0.00194919
Score: 0.859
Data Source: STRINGDB
UGT1A1
Tchem
Family: Enzyme
Novelty: 0.00173218
Score: 0.844
Data Source: STRINGDB
ABCB1
Tchem
Family: Transporter
Novelty: 0.00022166
Score: 0.843
Data Source: STRINGDB
NCOR2
Tchem
Family: TF
Novelty: 0.00127046
Score: 0.841
Data Source: STRINGDB
EPRS
Tchem
Family: Enzyme
Novelty: 0.00072148
Score: 0.836
Data Source: STRINGDB
Publication Statistics
PubMed Score  1616.64

PubMed score by year
PubTator Score  957.53

PubTator score by year
Patents
Amino Acid Sequence
Residue Counts
Sequence
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMK
1-70
RNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGV
70-140
QGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLK
140-210
VSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAA
210-280
FELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFS
280-350
PDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPF
350-420
ATPLMQELFGITGS
420-434
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS