You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
PEX14
Peroxisomal membrane protein PEX14

Protein Classes
Protein Summary
Description
Peroxisome membrane protein that is an essential component of the peroxisomal import machinery. Functions as a docking factor for the predominantly cytoplasmic PTS1 receptor (PEX5). Plays a key role for peroxisome movement through a direct interaction with tubulin. This gene encodes an essential component of the peroxisomal import machinery. The protein is integrated into peroxisome membranes with its C-terminus exposed to the cytosol, and interacts with the cytosolic receptor for proteins containing a PTS1 peroxisomal targeting signal. The protein also functions as a transcriptional corepressor and interacts with a histone deacetylase. A mutation in this gene results in one form of Zellweger syndrome. [provided by RefSeq, Jul 2008]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000356607
  • ENSP00000349016
  • ENSG00000142655

Symbol
  • NAPP2
  • PBD13A
  • Pex14p
  • dJ734G22.2
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
disease perturbation
0.96
virus perturbation
0.94
biological process
0.83
cellular component
0.8
transcription factor binding site profile
0.74


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.24   (req: < 5)
Gene RIFs: 16   (req: <= 3)
Antibodies: 255   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 37.24   (req: >= 5)
Gene RIFs: 16   (req: > 3)
Antibodies: 255   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 20
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (3)
1 – 3 of 3
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (8)
Class I peroxisomal membrane protein import (R-HSA-9603798)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 7
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Class I peroxisomal membrane protein import
Reactome
E3 ubiquitin ligases ubiquitinate target proteins
Reactome
Metabolism of proteins
Reactome
Peroxisomal protein import
Reactome
Post-translational protein modification
Name
Explore in Pharos
Explore in Source
Class I peroxisomal membrane protein import
E3 ubiquitin ligases ubiquitinate target proteins
Metabolism of proteins
Peroxisomal protein import
Post-translational protein modification
Protein-Protein Interactions (123)
1 – 10 of 123
IKZF5
Tbio
Family: TF
Novelty: 1
p_int: 0.999949369
p_ni: 0.000050631
Data Source: BioPlex
CROCC
Tbio
Novelty: 0.04047137
p_int: 0.999532474
p_ni: 0.000467523
p_wrong: 3e-9
Data Source: BioPlex
CCL4
Tbio
Novelty: 0.00091965
p_int: 0.999095236
p_ni: 0.000904764
Score: 0.248
Data Source: BioPlex,STRINGDB
HOMER3
Tbio
Novelty: 0.06696084
p_int: 0.998591363
p_ni: 0.001408637
Data Source: BioPlex
FOXJ1
Tbio
Family: TF
Novelty: 0.00949494
p_int: 0.991703632
p_ni: 0.008296368
Score: 0.175
Data Source: BioPlex,STRINGDB
GPR156
Tdark
Family: GPCR
Novelty: 0.46666667
p_int: 0.971942438
p_ni: 0.028057562
Data Source: BioPlex
NEU2
Tbio
Family: Enzyme
Novelty: 0.00721856
p_int: 0.960190093
p_ni: 0.039809907
Score: 0.177
Data Source: BioPlex,STRINGDB
AP2M1
Tbio
Novelty: 0.01240983
p_int: 0.958356475
p_ni: 0.041643525
Data Source: BioPlex
TP63
Tbio
Family: TF
Novelty: 0.00114506
p_int: 0.937288335
p_ni: 0.062711665
Score: 0.169
Data Source: BioPlex,STRINGDB
P4HA3
Tbio
Family: Enzyme
Novelty: 0.04334371
p_int: 0.924375086
p_ni: 0.075624914
Data Source: BioPlex
Publication Statistics
PubMed Score  37.24

PubMed score by year
PubTator Score  43.11

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MASSEQAEQPSQPSSTPGSENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQS
1-70
GTAADEPSSLGPATQVVPVQPPHLISQPYSPAGSRWRDYGALAIIMAGIAFGFHQLYKKYLLPLILGGRE
70-140
DRKQLERMEAGLSELSGSVAQTVTQLQTTLASVQELLIQQQQKIQELAHELAAAKATTSTNWILESQNIN
140-210
ELKSEINSLKGLLLNRRQFPPSPSAPKIPSWQIPVKSPSPSSPAAVNHHSSSDISPVSNESTSSSPGKEG
210-280
HSPEGSTVTYHLLGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDCLGVQREDR
280-350
RGGDGQINEQVEKLRRPEGASNESERD
350-377
MASSEQAEQPSQPSSTPGSENVLPREPLIATAVKFLQNSRVRQSPLATRRAFLKKKGLTDEEIDMAFQQSGTAADEPSSLGPATQVVPVQPPHLISQPYSPAGSRWRDYGALAIIMAGIAFGFHQLYKKYLLPLILGGREDRKQLERMEAGLSELSGSVAQTVTQLQTTLASVQELLIQQQQKIQELAHELAAAKATTSTNWILESQNINELKSEINSLKGLLLNRRQFPPSPSAPKIPSWQIPVKSPSPSSPAAVNHHSSSDISPVSNESTSSSPGKEGHSPEGSTVTYHLLGPQEEGEGVVDVKGQVRMEVQGEEEKREDKEDEEDEEDDDVSHVDEEDCLGVQREDRRGGDGQINEQVEKLRRPEGASNESERD