You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
TBCA
Tubulin-specific chaperone A

Protein Summary
Description
Tubulin-folding protein; involved in the early step of the tubulin folding pathway. The product of this gene is one of four proteins (cofactors A, D, E, and C) involved in the pathway leading to correctly folded beta-tubulin from folding intermediates. Cofactors A and D are believed to play a role in capturing and stabilizing beta-tubulin intermediates in a quasi-native confirmation. Cofactor E binds to the cofactor D/beta-tubulin complex; interaction with cofactor C then causes the release of beta-tubulin polypeptides that are committed to the native state. This gene encodes chaperonin cofactor A. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000306388
  • ENSP00000306362
  • ENSG00000171530
  • ENST00000380377
  • ENSP00000369736
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.88
tissue sample
0.69
disease perturbation
0.68
transcription factor binding site profile
0.68
transcription factor perturbation
0.68


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 79.14   (req: < 5)
Gene RIFs: 4   (req: <= 3)
Antibodies: 242   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 79.14   (req: >= 5)
Gene RIFs: 4   (req: > 3)
Antibodies: 242   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 6
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Pathways (3)
Metabolism of proteins (R-HSA-392499)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 3 of 3
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Metabolism of proteins
Reactome
Post-chaperonin tubulin folding pathway
Reactome
Protein folding
Name
Explore in Pharos
Explore in Source
Metabolism of proteins
Post-chaperonin tubulin folding pathway
Protein folding
Gene Ontology Terms (10)
Items per page:
10
1 – 3 of 3
GO Term
Evidence
Assigned by
Inferred from High Throughput Direct Assay (HDA)
UniProtKB
Traceable Author Statement (TAS)
ProtInc
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (72)
1 – 10 of 72
MICAL1
Tbio
Family: Enzyme
Novelty: 0.01559445
p_int: 0.997747598
p_ni: 0.002252129
p_wrong: 2.73e-7
Data Source: BioPlex
PLS1
Tbio
Novelty: 0.0040352
p_int: 0.944135845
p_ni: 0.055672931
p_wrong: 0.000191224
Data Source: BioPlex
GNAZ
Tbio
Novelty: 0.02343957
p_int: 0.766652083
p_ni: 0.05003937
p_wrong: 0.183308547
Data Source: BioPlex
TBCE
Tbio
Novelty: 0.00382883
Score: 0.995
Data Source: STRINGDB
TBCD
Tbio
Novelty: 0.01673453
Score: 0.99
Data Source: Reactome,STRINGDB
TUBA4A
Tchem
Novelty: 0.02626744
Score: 0.983
Data Source: STRINGDB
TUBB2A
Tclin
Novelty: 0.02116297
Score: 0.982
Data Source: STRINGDB
TUBB2B
Tclin
Novelty: 0.04266415
Score: 0.959
Data Source: STRINGDB
TUBB4A
Tclin
Novelty: 0.00101981
Score: 0.958
Data Source: STRINGDB
TUBB4B
Tclin
Novelty: 0.08790814
Score: 0.957
Data Source: STRINGDB
Publication Statistics
PubMed Score  79.14

PubMed score by year
PubTator Score  38.29

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRR
1-70
LEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA
70-108
MADPRVRQIKIKTGVVKRLVKEKVMYEKEAKQQEEKIEKMRAEDGENYDIKKQAEILQESRMMIPDCQRRLEAAYLDLQRILENEKDLEEAEEYKEARLVLDSVKLEA