You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ALOX12B
Arachidonate 12-lipoxygenase, 12R-type

Protein Summary
Description
Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Mainly converts arachidonic acid to (12R)-hydroperoxyeicosatetraenoic acid/(12R)-HPETE and minor stereoisomers. In the skin, acts upstream of ALOXE3 on the lineolate moiety of esterified omega-hydroxyacyl-sphingosine (EOS) ceramides to produce an epoxy-ketone derivative, a crucial step in the conjugation of omega-hydroxyceramide to membrane proteins. Therefore plays a crucial role in the synthesis of corneocytes lipid envelope and the establishment of the skin barrier to water loss. May also play a role in the regulation of the expression of airway mucins. This gene encodes an enzyme involved in the conversion of arachidonic acid to 12R-hydroxyeicosatetraenoic acid. Mutations in this gene are associated with nonbullous congenital ichthyosiform erythroderma. [provided by RefSeq, Sep 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000319144
  • ENSP00000315167
  • ENSG00000179477
  • ENST00000647874
  • ENSP00000497784

Symbol
  • ARCI2
  • 12R-LOX
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
protein domain
0.92
gene perturbation
0.8
biological process
0.75
molecular function
0.53
trait
0.46


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 25.24   (req: < 5)
Gene RIFs: 21   (req: <= 3)
Antibodies: 92   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 25.24   (req: >= 5)
Gene RIFs: 21   (req: > 3)
Antibodies: 92   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 16
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Pathways (11)
Arachidonic acid metabolism (R-HSA-2142753)

Click on a row in the table to change the structure displayed.

Items per page:
1 – 5 of 5
Data Source
Name
Explore in Pharos
Explore in Source
Reactome
Arachidonic acid metabolism
Reactome
Fatty acid metabolism
Reactome
Metabolism
Reactome
Metabolism of lipids
Reactome
Synthesis of 12-eicosatetraenoic acid derivatives
Name
Explore in Pharos
Explore in Source
Arachidonic acid metabolism
Fatty acid metabolism
Metabolism
Metabolism of lipids
Synthesis of 12-eicosatetraenoic acid derivatives
Gene Ontology Terms (17)
Items per page:
10
1 – 4 of 4
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
UniProtKB
Inferred from Mutant Phenotype (IMP)
UniProtKB
Inferred from Sequence or structural Similarity (ISS)
UniProtKB
Inferred from Electronic Annotation (IEA)
InterPro
Protein-Protein Interactions (89)
1 – 10 of 89
CCDC51
Tdark
Novelty: 1.55555556
p_int: 0.995684976
p_ni: 0.004315023
p_wrong: 2e-9
Data Source: BioPlex
ZIC1
Tbio
Family: TF
Novelty: 0.00309271
p_int: 0.994106513
p_ni: 0.005893487
Data Source: BioPlex
ZSCAN12
Tdark
Family: TF
Novelty: 0.40909091
p_int: 0.980878607
p_ni: 0.019121393
Data Source: BioPlex
TBC1D22B
Tbio
Novelty: 6
p_int: 0.976417165
p_ni: 0.023582835
Data Source: BioPlex
FTH1
Tbio
Novelty: 0.00088724
p_int: 0.964740329
p_ni: 0.035259671
Data Source: BioPlex
CCDC103
Tbio
Novelty: 0.007955
p_int: 0.958547833
p_ni: 0.041452167
Data Source: BioPlex
NPPA
Tchem
Novelty: 0.00054421
p_int: 0.950092619
p_ni: 0.049907381
Data Source: BioPlex
DPPA4
Tbio
Novelty: 0.09606623
p_int: 0.949991514
p_ni: 0.050008486
Data Source: BioPlex
AIRE
Tbio
Family: TF; Epigenetic
Novelty: 0.00109835
p_int: 0.918632508
p_ni: 0.081367491
Score: 0.183
Data Source: BioPlex,STRINGDB
UBE3A
Tbio
Family: Enzyme
Novelty: 0.00207153
p_int: 0.892246499
p_ni: 0.107753501
Data Source: BioPlex
Publication Statistics
PubMed Score  25.24

PubMed score by year
PubTator Score  32.44

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGRDFATGAVGQYTVQCPQDLGELIIIRLH
1-70
KERYAFFPKDPWYCNYVQICAPNGRIYHFPAYQWMDGYETLALREATGKTTADDSLPVLLEHRKEEIRAK
70-140
QDFYHWRVFLPGLPSYVHIPSYRPPVRRHRNPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASF
140-210
FVRLGPMALAFKVRGLLDCKHSWKRLKDIRKIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRC
210-280
TRIPDKFPVTDDMVAPFLGEGTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLHFGPEGK
280-350
MMPIAIQLSQTPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEAFCLALLRNLPMC
350-420
HPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGV
420-490
QDLPGYYYRDDSLAVWNALEKYVTEIITYYYPSDAAVEGDPELQSWVQEIFKECLLGRESSGFPRCLRTV
490-560
PELIRYVTIVIYTCSAKHAAVNTGQMEFTAWMPNFPASMRNPPIQTKGLTTLETFMDTLPDVKTTCITLL
560-630
VLWTLSREPDDRRPLGHFPDIHFVEEAPRRSIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSIS
630-700
I
700-701
MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGRDFATGAVGQYTVQCPQDLGELIIIRLHKERYAFFPKDPWYCNYVQICAPNGRIYHFPAYQWMDGYETLALREATGKTTADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVRRHRNPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIRKIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVTDDMVAPFLGEGTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLHFGPEGKMMPIAIQLSQTPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEAFCLALLRNLPMCHPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLYLPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEIITYYYPSDAAVEGDPELQSWVQEIFKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNTGQMEFTAWMPNFPASMRNPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRRPLGHFPDIHFVEEAPRRSIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI