You are using an outdated browser. Please upgrade your browser to improve your experience.

Tdark
SNN
Stannin

Protein Summary
Description
Plays a role in the toxic effects of organotins (PubMed:15269288). Plays a role in endosomal maturation (PubMed:27015288).
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000329565
  • ENSP00000329287
  • ENSG00000184602
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
kinase perturbation
0.84
PubMedID
0.7
virus perturbation
0.59
microRNA
0.58
protein domain
0.58


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 225.56   (req: < 5)
Gene RIFs: 1   (req: <= 3)
Antibodies: 8   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 225.56   (req: >= 5)
Gene RIFs: 1   (req: > 3)
Antibodies: 8   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 2
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein Data Bank (1)
1 – 1 of 1
PDB Structure Id
Ligand
Method
Resolution (Å)
M.W. (kDa)
Pub Year
Title
PDB Structure Id
M.W.
Resolution
Pub Year
Gene Ontology Terms (5)
Items per page:
10
1 – 1 of 1
GO Term
Evidence
Assigned by
Inferred from Direct Assay (IDA)
CAFA
Protein-Protein Interactions (34)
1 – 10 of 34
MTDH
Tbio
Novelty: 0.00211478
p_int: 0.999972217
p_ni: 0.000027783
Score: 0.309
Data Source: BioPlex,STRINGDB
TMX1
Tbio
Novelty: 0.01558923
p_int: 0.998035127
p_ni: 0.001964873
Score: 0.196
Data Source: BioPlex,STRINGDB
TES
Tbio
Novelty: 0.00112939
p_int: 0.997352366
p_ni: 0.002645344
p_wrong: 0.00000229
Score: 0.243
Data Source: BioPlex,STRINGDB
C1orf131
Tdark
p_int: 0.944091511
p_ni: 0.048354637
p_wrong: 0.007553852
Score: 0.282
Data Source: BioPlex,STRINGDB
FST
Tbio
Novelty: 0.00081807
Score: 0.785
Data Source: STRINGDB
SPIN4
Tdark
Novelty: 0.21428571
Score: 0.733
Data Source: STRINGDB
TXNDC11
Tbio
Novelty: 0.10709732
Score: 0.681
Data Source: STRINGDB
VIPR1
Tchem
Family: GPCR
Novelty: 0.00222991
Score: 0.652
Data Source: STRINGDB
ADAMTS3
Tbio
Family: Enzyme
Novelty: 0.00834011
Score: 0.646
Data Source: STRINGDB
YWHAZ
Tbio
Novelty: 0.00235606
Score: 0.621
Data Source: STRINGDB
Publication Statistics
PubMed Score  225.56

PubMed score by year
PubTator Score  17.03

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGP
1-70
CVERKAKLMTPNGPEVHG
70-88
MSIMDHSPTTGVVTVIVILIAIAALGALILGCWCYLRLQRISQSEDEESIVGDGETKEPFLLVQYSAKGPCVERKAKLMTPNGPEVHG