You are using an outdated browser. Please upgrade your browser to improve your experience.

Tbio
ZPR1
Zinc finger protein ZPR1

Protein Summary
Description
Acts as a signaling molecule that communicates proliferative growth signals from the cytoplasm to the nucleus. Plays a role for the localization and accumulation of the survival motor neuron protein SMN1 in sub-nuclear bodies, including gems and Cajal bodies. Induces neuron differentiation and stimulates axonal growth and formation of growth cone in spinal cord motor neurons. Plays a role in the splicing of cellular pre-mRNAs. May be involved in H(2)O(2)-induced neuronal cell death. The protein encoded by this gene is found in the cytoplasm of quiescent cells but translocates to the nucleolus in proliferating cells. The encoded protein interacts with survival motor neuron protein (SMN1) to enhance pre-mRNA splicing and to induce neuronal differentiation and axonal growth. Defects in this gene or the SMN1 gene can cause spinal muscular atrophy. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Uniprot Accession IDs
Gene Name
Ensembl ID
  • ENST00000227322
  • ENSP00000227322
  • ENSG00000109917

Symbol
  • ZNF259
  • ZNF259
Illumination Graph
Knowledge Table
Most Knowledge About
Knowledge Value (0 to 1 scale)
trait
1
biological process
0.95
co-expressed gene
0.85
kinase perturbation
0.81
histone modification site profile
0.79


IDG Development Level Summary
Tdark

These are targets about which virtually nothing is known. They do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 31.9   (req: < 5)
Gene RIFs: 15   (req: <= 3)
Antibodies: 254   (req: <= 50)
Tbio

These targets do not have known drug or small molecule activities
- AND - satisfy two or more of the following criteria:

Pubmed score: 31.9   (req: >= 5)
Gene RIFs: 15   (req: > 3)
Antibodies: 254   (req: > 50)

- OR - satisfy the following criterion:

Gene Ontology Terms: 24
Tchem

Target has at least one ChEMBL compound with an activity cutoff of < 30 nM - AND - satisfies the preceding conditions

Active Ligand: 0
Tclin

Target has at least one approved drug - AND - satisfies the preceding conditions

Active Drug: 0
Protein-Protein Interactions (122)
1 – 10 of 122
NEU4
Tchem
Family: Enzyme
Novelty: 0.03637342
p_int: 0.999460295
p_ni: 0.000539704
p_wrong: 1e-9
Score: 0.187
Data Source: BioPlex,STRINGDB
ABHD5
Tbio
Family: Enzyme
Novelty: 0.00998736
p_int: 0.996169763
p_ni: 0.003830237
Score: 0.258
Data Source: BioPlex,STRINGDB
C17orf53
Tdark
Novelty: 2.91666667
p_int: 0.937393825
p_ni: 0.062599777
p_wrong: 0.000006398
Score: 0.269
Data Source: BioPlex,STRINGDB
ZBTB42
Tbio
Family: TF
Novelty: 0.47619048
p_int: 0.921245465
p_ni: 0.078753668
p_wrong: 8.68e-7
Score: 0.187
Data Source: BioPlex,STRINGDB
EEF1A1
Tchem
Novelty: 0.00084049
p_int: 0.885290668
p_ni: 0.11470933
p_wrong: 2e-9
Score: 0.922
Data Source: BioPlex,STRINGDB
IKBKG
Tbio
Family: Kinase
Novelty: 0.00081998
p_int: 0.774387746
p_ni: 0.225612249
p_wrong: 6e-9
Data Source: BioPlex
DDX20
Tbio
Family: Enzyme
Novelty: 0.02595469
Score: 0.951
Data Source: STRINGDB
SMN1
Tbio
Family: Epigenetic
Novelty: 0.00082695
Score: 0.95
Data Source: STRINGDB
GEMIN2
Tbio
Novelty: 0.026147
Score: 0.945
Data Source: STRINGDB
GEMIN7
Tbio
Novelty: 0.07834454
Score: 0.943
Data Source: STRINGDB
Publication Statistics
PubMed Score  31.90

PubMed score by year
PubTator Score  24.16

PubTator score by year
Amino Acid Sequence
Residue Counts
Sequence
MAASGAVEPGPPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESLCMNCYCNGMTRLLLTKIPFF
1-70
REIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQK
70-140
GALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHA
140-210
PQKDDALVITHYNRTRQQEEMLGLQEEAPAEKPEEEDLRNEVLQFSTNCPECNAPAQTNMKLVQIPHFKE
210-280
VIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGK
280-350
FTTLEGLLKDIRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAP
350-420
EDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR
420-459
MAASGAVEPGPPGAAVAPSPAPAPPPAPDHLFRPISAEDEEQQPTEIESLCMNCYCNGMTRLLLTKIPFFREIIVSSFSCEHCGWNNTEIQSAGRIQDQGVRYTLSVRALEDMNREVVKTDSAATRIPELDFEIPAFSQKGALTTVEGLITRAISGLEQDQPARRANKDATAERIDEFIVKLKELKQVASPFTLIIDDPSGNSFVENPHAPQKDDALVITHYNRTRQQEEMLGLQEEAPAEKPEEEDLRNEVLQFSTNCPECNAPAQTNMKLVQIPHFKEVIIMATNCENCGHRTNEVKSGGAVEPLGTRITLHITDASDMTRDLLKSETCSVEIPELEFELGMAVLGGKFTTLEGLLKDIRELVTKNPFTLGDSSNPGQTERLQEFSQKMDQIIEGNMKAHFIMDDPAGNSYLQNVYAPEDDPEMKVERYKRTFDQNEELGLNDMKTEGYEAGLAPQR